Future proprio Ioniq 2018 besoin d'aide pour choix de borne

Vous vous intéressez aux voitures électriques, mais n'êtes pas convaincu? Posez vos questions ici, la communauté y répondra!

Modérateurs : StefLevert79, rpm92109, Didier Ernotte, Martin AVEQ

Bruno dufour
Membre espoir montant
Membre espoir montant
Messages : 126
Enregistré le : sam. août 11, 2018 9:51 pm
Localisation : Lorraine

Re: besoin d'aide pour choix de borne

Message par Bruno dufour » lun. nov. 26, 2018 10:19 pm

Pis , il est comment le câble de Flo?
Comme la appareil sera devant la maison, je veux que ça soit est esthétique.

Bruno dufour
Membre espoir montant
Membre espoir montant
Messages : 126
Enregistré le : sam. août 11, 2018 9:51 pm
Localisation : Lorraine

Re: besoin d'aide pour choix de borne

Message par Bruno dufour » lun. nov. 26, 2018 10:25 pm

J'attends une Kona électrique en février. Quelqu'un a une idée du type de prise 240 v qui fonctionne avec le chargeur fourni avec la voiture?

espresso
Nouveau membre
Nouveau membre
Messages : 13
Enregistré le : mar. août 28, 2018 10:23 am

Re: besoin d'aide pour choix de borne

Message par espresso » mar. déc. 04, 2018 8:40 pm

Raide.
Vraiment plus que le cable sur ma EVduty. il ne fait penser au gros cable de soudeuse de garage, gros et mou :-)

Meme c'est temps-ci ( -4 , -6 C) les cable des 4 FLO au travail sont surprenament raide.
_______________________________
Espresso

gyroflic
Membre régulier
Membre régulier
Messages : 418
Enregistré le : dim. août 20, 2017 9:00 am

Re: besoin d'aide pour choix de borne

Message par gyroflic » mar. déc. 11, 2018 1:31 pm

La plus esthetique c est la Siemens Versycharge . Mais elle est vendu avec une garantie de remplacement de 1 ans . Ensuite pas de service !
Mais pour une borne bien construite c est la meilleure !
Il faut parcontre achete le pistolet comforme en angle 40 degres et non a angle droit comme la premiere generation !

ElectronLibre
Membre espoir montant
Membre espoir montant
Messages : 143
Enregistré le : sam. août 04, 2018 12:04 pm

Re: besoin d'aide pour choix de borne

Message par ElectronLibre » mar. déc. 11, 2018 3:23 pm

Quote to: gyroflic


La plus esthetique c est la Siemens Versycharge . Mais elle est vendu avec une garantie de remplacement de 1 ans .
...

Tout est vraiment une question de goût… Vraiment pas mon genre cette borne.

Bruno dufour
Membre espoir montant
Membre espoir montant
Messages : 126
Enregistré le : sam. août 11, 2018 9:51 pm
Localisation : Lorraine

Re: besoin d'aide pour choix de borne

Message par Bruno dufour » mar. déc. 11, 2018 9:08 pm

Return-Path:
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti1d2t14 (Cyrus 3.1.5-681-g8713b31-fmstable-20181205v1) with LMTPA;
Tue, 11 Dec 2018 20:08:17 -0500
X-Cyrus-Session-Id: sloti1d2t14-1861439-1544576897-2-1836601317126198189
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-score: 1.3
X-Spam-hits: FREEMAIL_FROM 0.001, HTML_MESSAGE 0.001, ME_BETA_RULES 0.01,
RCVD_IN_DNSWL_NONE -0.0001, SPF_PASS -0.001, URI_HEX 1.313, LANGUAGES fr,
BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP='209.85.166.49', Host='mail-io1-f49.google.com', Country='US',
FromHeader='com', MailFrom='com'
X-Spam-charsets: to='UTF-8', plain='UTF-8', html='UTF-8'
X-Resolved-to: ml+s1097349n102170h16@n5.nabble.com
X-Delivered-to: ml+s1097349n102170h16@n5.nabble.com
X-Mail-from: bruno.dufour.act@gmail.com
Received: from mx5 ([10.202.2.204])
by compute1.internal (LMTPProxy); Tue, 11 Dec 2018 20:08:17 -0500
Received: from mx5.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 5F1FAC68F6
for ; Tue, 11 Dec 2018 20:08:16 -0500 (EST)
Received: from mx5.messagingengine.com (localhost [127.0.0.1])
by mx5.messagingengine.com (Authentication Milter) with ESMTP
id F928CECCA4E;
Tue, 11 Dec 2018 20:08:16 -0500
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm1; t=
1544576896; b=Oeg9H72cGxEhLqzBsz5VZeoqUIdQeE1qX+EtuNrHxioYAZB1dm
FbIfnAzKkUohBRTxRb6lqa9cts+obbDpKkETwQM9GMm2xapkS3FxRYPA5GIDkkln
ge4ee/29+SAgtX+zxcHHn8UzUj1UM7ptXjs/WdLoBmxve22qVGZsdX3Qsm3ts0kh
QNxWBoqhNREvhfzS5HpWfXA6+CtTC++4XH88cJoERNlRouVrfiSVuZJtdc7tPTZ0
36IiIzlQ341/k5DtnHzc3PkGHLVAVQBuKjJhTn/qVgyGt4xg7Gd8CGH1QcMYkpoE
NCbrzD7YvcKrei8CNYmIQjY+/1hM+q6Xx4Jg==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=mime-version:references:in-reply-to:from
:date:message-id:subject:to:content-type; s=fm1; t=1544576896;
bh=Jf5jlj75T3dmcxbVe2aKc9djiBbvemqfvRDfnGFkwow=; b=cIJres3n+ICZ
xJb8bzRjZN0dWHRJwcantMgc/OOzIGFLPYUX0UsqUj3tiSmefHUA1NKTH1mrYcKW
Q81nkiJWcRxUsrjEY0IKe6tjcNGHk9j5qvozMalcgANnMiYR/a6Z1wpN88kTq4GM
Q7QjsgeBJs+5QFpioyK6XNAOicl9O4BTAIt6YHCC8Q3RAy62npNI84skbEKSaRwP
lR/3PLp6MZ/FuBvCpymsGGzzRCKOju86EYuSE1ojfyBmvvGiecK2tGHHfHDvb+5s
cEZArS9GtRnFaAJO2Kgx9hdXcXiGM5vBZjt8+KaOt/bx6/ZuD3EscPCN8FKU0068
tqYs6XMtdA==
ARC-Authentication-Results: i=1; mx5.messagingengine.com; arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=vIr+WMSB header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.166.49 (mail-io1-f49.google.com);
spf=pass smtp.mailfrom=bruno.dufour.act@gmail.com
smtp.helo=mail-io1-f49.google.com;
x-aligned-from=pass (Address match);
x-cm=none score=0;
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=GumHZ24K;
x-ptr=pass smtp.helo=mail-io1-f49.google.com
policy.ptr=mail-io1-f49.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0
Authentication-Results: mx5.messagingengine.com;
arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=vIr+WMSB header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.166.49 (mail-io1-f49.google.com);
spf=pass smtp.mailfrom=bruno.dufour.act@gmail.com
smtp.helo=mail-io1-f49.google.com;
x-aligned-from=pass (Address match);
x-cm=none score=0;
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=GumHZ24K;
x-ptr=pass smtp.helo=mail-io1-f49.google.com
policy.ptr=mail-io1-f49.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0
X-ME-VSSU: VW5zdWI9aHR0cDovL21lbnUtcHJpbmNpcGFsLWZvcnVtcy1hdmVxLjEwOTczNDkubjUubm
FiYmxlLmNvbS90ZW1wbGF0ZS9OYW1sU2VydmxldC5qdHA_bWFjcm89dW5zdWJzY3JpYmVf
YnlfY29kZSZub2RlPTg0OTQ0JmNvZGU9WW5KMWJtOHVaSFZtYjNWeUxtRmpkRUJuYldGcG
JDNWpiMjE4T0RRNU5EUjhMVEV4TXpFNU1ERTNNakE9
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedtkedrudegkedgfeduucetufdoteggodetrfdotf
fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvnecu
uegrihhlohhuthemuceftddtnecunecujfgurhepgghfjgfhfffkuffvtgesrgdtreertd
dtjeenucfhrhhomhepsghruhhnohcuughufhhouhhruceosghruhhnohdrughufhhouhhr
rdgrtghtsehgmhgrihhlrdgtohhmqeenucffohhmrghinhepnhgrsggslhgvrdgtohhmne
cukfhppedvtdelrdekhedrudeiiedrgeelnecurfgrrhgrmhepihhnvghtpedvtdelrdek
hedrudeiiedrgeelpdhhvghlohepmhgrihhlqdhiohduqdhfgeelrdhgohhoghhlvgdrtg
homhdpmhgrihhlfhhrohhmpeeosghruhhnohdrughufhhouhhrrdgrtghtsehgmhgrihhl
rdgtohhmqecuuffkkgfgpeejfedvkeenucevlhhushhtvghrufhiiigvpedt
X-ME-VSCategory: clean
X-CM-Envelope: MS4wfPsAdoc/FOmhZwufUV/EKqFq2A3r8wCw1TZEZj1sOfWAzraAifo8vLoxXkx4U0JdvR6ZxK+Bq+n3Ua5QNFvTEsiAG8D7DAxM3MBUhScKfivriYSZMcJb
kpd9nzaxHYVaRuizWmYDMWvN7yi77pQSBy/aaEeoGQOj8T0wrUCvpyMBKEF1gjzxxqwzoCoPNXs8tBX7S+HFtTJIcncMw7kQ4flSbLvER8otF7/MsPXAO514
X-CM-Analysis: v=2.3 cv=KuKcJleN c=1 sm=1 tr=0 a=ccA1FXCYYycThNn3AvCQpg==:117
a=x7bEGLp0ZPQA:10 a=oazV02fXfKsA:10 a=2ur7OfE09M0A:10 a=9I5xiGouAAAA:8
a=dAI4mX9L-H2XvYmXXDsA:9 a=QEXdDO2ut3YA:10 a=pIPunGRmfKcA:10 a=W4WxS7vdATEA:10
a=b96s_ZNBJdB-re9AGbwA:9 a=0-r4ZotW8eCbk1jq:21 a=ARFN2YZ7Uv8kHtb7LS-q:22
X-ME-CMScore: 0
X-ME-CMCategory: none
Received-SPF: pass
(gmail.com ... _spf.google.com: Sender is authorized to use 'bruno.dufour.act@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched))
receiver=mx5.messagingengine.com;
identity=mailfrom;
envelope-from="bruno.dufour.act@gmail.com";
helo=mail-io1-f49.google.com;
client-ip=209.85.166.49
Received: from mail-io1-f49.google.com (mail-io1-f49.google.com [209.85.166.49])
(using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits))
(No client certificate requested)
by mx5.messagingengine.com (Postfix) with ESMTPS
for ; Tue, 11 Dec 2018 20:08:15 -0500 (EST)
Received: by mail-io1-f49.google.com with SMTP id r9so13528121ioa.1
for ; Tue, 11 Dec 2018 17:08:15 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20161025;
h=mime-version:references:in-reply-to:from:date:message-id:subject:to;
bh=Jf5jlj75T3dmcxbVe2aKc9djiBbvemqfvRDfnGFkwow=;
b=vIr+WMSBvyBNjjr/1KvSfVm05QOjsxVxbkKhO1EYB0ofdQqYmFUDHqEf5w+23A1oOQ
BsT/Kxcsv8X7Z/XmBci+2GERWvt6qrJnuzRdEQ9ABXBOcVgEVEZLBnhzylRSgK0NqCbM
5cfeC2MZW85xPEtlvxwUTUe5gLZWzDKZQmpxwYrfu/SrfPmPNIQwdqmu1m7jxMXW87Qg
1/GADdC6FdP0LgpHp+NQSyFYENFIPIEcPuYVvaLTzcLrQZEr+UgylUWe4JGSuS2Xs+pt
yTz7FE/H9URr4SXz+P7DbGQ1OeUiAUMoss8H04Yh3BV65D5cYBVnByEbFBrvUin4wqjJ
HQ0A==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:mime-version:references:in-reply-to:from:date
:message-id:subject:to;
bh=Jf5jlj75T3dmcxbVe2aKc9djiBbvemqfvRDfnGFkwow=;
b=GumHZ24Km1JiTu+WWxgJBa11v9N5885vWqzwquW2IIVDlpbd3Ihg0Y0mosjprdlMsi
vYvlfR1Pd94m3Evjl1jkoaEoe8CI8hDs6U4I+qGg2AlMM8kezbRQLueIBJ/Fs2xysMC/
rnZTaDQV4DJLO8AkCdu0TE07u1f4iXaAf77noU17repJy3q1QgVZK7z/rNAYBzZZmDHb
6v4+awLpEEhT5pCPwK/eKgHX41Fu18zdJSq9G5VmU9UG8/Kd2XXiyZYs8VfurGsRM9N/
OteARukUftqnXbVEilF/+AGWmAO4CxrSQIUVgsIDW4Bz5S6K/CRBrle2qr/xxNXBq/gb
RCvA==
X-Gm-Message-State: AA+aEWYh3tOrplUpHldVXsvgcSNZk6R8kVO9BSc/RYKhrZo2pJu22Ea1
4l2RvIRSw38aFW7EZtWKxitEF7RJv+Ralb4FxmL7
X-Google-Smtp-Source: AFSGD/X9pQNf+aGWLh8rO/S15FhSUEt7EsuKthugQYqpzw1YHxBYR2mzhKB1VnFaAKtFBAWepo7Abe1dYSwXMj9K+cA=
X-Received: by 2002:a5d:9a03:: with SMTP id s3mr15662499iol.69.1544576893897;
Tue, 11 Dec 2018 17:08:13 -0800 (PST)
MIME-Version: 1.0
References: <1518708800835-84944.post@n5.nabble.com> <1536874832530-98326.post@n5.nabble.com>
<1536931075583-98354.post@n5.nabble.com> <1536985173565-98367.post@n5.nabble.com>
<1543285167045-101461.post@n5.nabble.com> <1544549488911-102161.post@n5.nabble.com>
<1544556188245-102170.post@n5.nabble.com>
In-Reply-To: <1544556188245-102170.post@n5.nabble.com>
From: bruno dufour
Date: Tue, 11 Dec 2018 20:08:02 -0500
Message-ID:
Subject: Re: besoin d'aide pour choix de borne
To: =?UTF-8?Q?ElectronLibre_=5Bvia_Menu_principal_=2D_Forums_AV=C3=89Q=5D?=
Content-Type: multipart/alternative; boundary="00000000000016d44a057cc8d568"

--00000000000016d44a057cc8d568
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Elle me para=C3=AEt fragile. Boitier en plastique.... Les hiver doit =C3=AA=
tre
difficile pour elle.

Le mar. 11 d=C3=A9c. 2018 14 h 23, ElectronLibre [via Menu principal - Foru=
ms
AV=C3=89Q] a =C3=A9crit :

> gyroflic wrote
> La plus esthetique c est la Siemens Versycharge . Mais elle est vendu ave=
c
> une garantie de remplacement de 1 ans .
> ...
>
> Tout est vraiment une question de go=C3=BBt=E2=80=A6 Vraiment pas mon gen=
re cette
> borne.
>
> ------------------------------
> Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=C3=A9 =
=C3=A0 la discussion
> ci-dessous:
>
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Future-proprio-Io=
niq-2018-besoin-d-aide-pour-choix-de-borne-tp84944p102170.html
> Pour vous d=C3=A9sabonner de Future proprio Ioniq 2018 besoin d'aide pour=
choix
> de borne, cliquez ici
> vlet.jtp?macro=3Dunsubscribe_by_code&node=3D84944&code=3DYnJ1bm8uZHVmb3VyLm=
FjdEBnbWFpbC5jb218ODQ5NDR8LTExMzE5MDE3MjA=3D>
> .
> NAML
> vlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml>
>

--00000000000016d44a057cc8d568
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Elle me para=C3=AEt fragile. Boitier en plastique.... Les=
hiver doit =C3=AAtre difficile pour elle.

te">
Le mar. 11 d=C3=A9c. 2018 14 h 23, ElectronLibre [via =
Menu principal - Forums AV=C3=89Q] < 70h16@n5.nabble.com">ml+s1097349n102170h16@n5.nabble.com> a =C3=A9cr=
it=C2=A0:
.8ex;border-left:1px #ccc solid;padding-left:1ex">

"m_7028736232956090874quote m_7028736232956090874dark-border-color">
ass=3D"m_7028736232956090874quote m_7028736232956090874light-border-color">
>gyroflic wrote

La plus esthetique c est =
la Siemens Versycharge . Mais elle est vendu avec une garantie de remplacem=
ent de 1 ans .

...


Tout est vraiment une question de go=C3=BBt=E2=80=A6 Vraiment pas mon genre=
cette borne.

=09
=09
=09









--00000000000016d44a057cc8d568--

mina40000
Messages : 1
Enregistré le : ven. janv. 25, 2019 1:12 pm

Re: besoin d'aide pour choix de borne

Message par mina40000 » ven. janv. 25, 2019 1:13 pm

Jaguar semble recommander la ChargePoint. Le modèle a une faible empreinte discrète (à installer sur une demeure vintage 1925) Alors que la Flo me semble bcp plus grosse et nécessite un PCL et prise électrique libre près du routeur pour assurer ses fonctions connectées.... https://ovo.fyi/brazzers/ https://ovo.fyi/youporn/ https://ovo.fyi/xhamster/

ElectronLibre
Membre espoir montant
Membre espoir montant
Messages : 143
Enregistré le : sam. août 04, 2018 12:04 pm

Re: besoin d'aide pour choix de borne

Message par ElectronLibre » ven. janv. 25, 2019 2:49 pm

Quote to: mina40000


Jaguar semble recommander la ChargePoint. Le modèle a une faible empreinte discrète (à installer sur une demeure vintage 1925) Alors que la Flo me semble bcp plus grosse et nécessite un PCL et prise électrique libre près du routeur pour assurer ses fonctions connectées....

La ChargePoint a une surface inférieure à celle d'une feuille de papier lettre (8.5 x 11). Elle est aussi très mince.
La Flo est un peu moins large mais plus longue et plus épaisse.

Pour la fonction intelligente, la ChargePoint se branche sur votre réseau WiFi, la Flo via HomePlug.

Si la ChargePoint vous intéresse et que vous n'êtes pas très pressé, surveillez le prix sur Amazon.ca puisque la borne est régulièrement escomptée - typiquement 840$ pour la version "hard-wired" avec câble de 7.6 m. C'est nettement inférieur à la Flo X5.

Répondre

Retourner vers « Questions de futurs propriétaires »