Futur intéressé, Quelques questions...

Vous vous intéressez aux voitures électriques, mais n'êtes pas convaincu? Posez vos questions ici, la communauté y répondra!

Modérateurs : StefLevert79, Didier Ernotte, rpm92109, Martin AVEQ

Windrider
Débutant
Débutant
Messages : 38
Enregistré le : dim. mars 10, 2019 6:11 pm

Futur intéressé, Quelques questions...

Message par Windrider » dim. mars 10, 2019 6:57 pm

Je suis très intéressé par une électrique comme prochaine voiture, j'ai donc quelques questions. (surement déjà posées par tous les futurs intéressés...)

Voici ce que je fais comme route, d"après votre expérience, est-ce bien adapté pour moi ?

Je fais 60 Km par jour pour aller travailler, en plus des quelques détours après le travail (parfois 50 km surtout l'hiver pour aller skier, donc il fait souvent en bas de - 15).

Il n'y a pas de borne au travail.

Surtout l'été, j'aime aller me promener dans les villages du Québec pour faire de la photographie ou simplement visiter, et ne pas avoir à payer de l'essence à chaque fois serait extraordinaire. En plus le roulement doux et silencieux est parfait pour la promenade les fenêtres ouvertes !

Je vais parfois voir la famille à Trois-Rivières, surtout l'hiver. Il n'y a pas de borne chez eux. Je dois donc me brancher en repartant... Un peu tannant... Je suis à Québec

Je vais plusieurs fois l'été à St-Joseph-de-la-Rive à partir de Québec. Il n'y a pas de borne au chalet, ni proche, et j'y reste parfois quelques jours.

Je dépasse rarement la limite de vitesse et je suis plutôt du genre à prendre les petites routes de campagne plutôt que les autoroutes.

Donc... :

Ça me prend une bonne autonomie, mais pas voiture la plus chère. Je crois que 200 serait correct, mais il ne faut pas que ça baisse trop en hiver. Une Leaf serait mon premier choix. Le total des paiements par mois de ma voiture à essence est plus cher que le coût d'une Leaf, mais est-ce le bon prix qui est indiqué sur le site du fabriquant ? Y'a-t-il des frais cachés etc.... ?

Le 8000$ du Gouvernement est-ce après les taxes et pour combien de temps encore ?

Ça ne me dérange pas d'arrêter quelques fois pour charger durant un plus long trajet, mais il ne faut pas que ça dure 45 minutes, et ne pas devoir chercher les bornes sans cesse et il faut qu'elles soit libres.

Il m'arrive souvent d'arriver chez moi et de repartir 30 minutes plus tard, il doit donc me rester de l'autonomie

Je suis en loyer, mais en bas. Bien situé pour mettre une borne, mais qu'arrive-t-il si je déménage? Est-ce-que que je paye un autre branchement ? Est-ce que ça doit être fait par le propriétaire du duplex?

Je fais une fois par an de plus long trajets, du genre Nouveau Brunswick, Montréal ou Magog. Quelle est votre expérience sur les long trajets ? D'après moi y'a pas de problème tant qu'il y a des bornes. En fait, je ne voie aucun inconvénient à la voiture électrique, tant qu'il y a des bornes....

Je ne suis pas très pressé pour l'instant, ma voiture sera finie de payée cet été et je vais la changer dès quelle coûtera des réparations, mais je commence à regarder car ça peux arriver plus vite qu'on crois et je pense sérieusement à une électrique.

Avatar du membre
Yvente
Membre Expert
Membre Expert
Messages : 2127
Enregistré le : sam. sept. 16, 2017 12:31 pm

Re: Futur intéressé, Quelques questions...

Message par Yvente » dim. mars 10, 2019 9:04 pm

Quote to: Windrider


j'ai donc quelques questions. (surement déjà posées par tous les futurs intéressés...)


Tes questions sont nombreuses et toutes pertinentes

Tu dis faire 60 km pour le travail et pas de prise électrique là bas (Même pas une prise 120 V de disponible ?) Donc pour l'aller-retour ça fait 120 km ? Correct ?
À ce 120 km tu ajoutes parfois un 50 km ?
Donc entre 120 km et 170 km quotidiennement sans bornes.

Pour choisir un modèle de VÉ il faut évaluer ce dont le véhicule offrira comme pire autonomie l'hiver dans les grands froids. Grosso-modo tu peux prendre l'autonomie affichée par le fabriquant et couper ça de moitié. Ça semble pessimiste comme approche mais ça sera la réalité quelques journées par hiver.

Pour la questions des bornes publiques c'est un coup de dé. Tu peux arriver et elle(s) est(sont) libre(s) ou devoir patienter pour ceux déjà en ligne pour une recharge. Et pour la vitesse de recharge dans les journées froides les recharges rapides aux bornes de 400V seront aussi plus lentes. Selon le modèle de véhicule électrique ça pourra varier; certains étant meilleurs que d'autres. Bref faut pas être serré dans l'horaire et prendre ça zen. Faire de longues distances en butinant d'une borne à l'autre est faisable mais personnellement je vois plus un VÉ comme étant un véhicule pour le quotidien du travail et des recharges domestiques. Pour les longs voyages une bornes à 400V va coûter presque le prix de l'essence. Quelqu'un qui fait des longs voyages va préférer une alternative à la batterie comme la génératrice qui se trouve dans la Volt.

Autre chose pour les bornes: Tu en as quelques unes rapides à 400V mais la majorité sont encore à du 240V. Ça aussi ça va varier ton temps de recharge avant de pouvoir reprendre la route. https://www.plugshare.com

Pour les prix dans le neuf il y a peu de négociations possible ... et le 8000$ sera donné lorsque l'achat sera complété au complet donc: prix du véhicule + taxes et seulement ensuite on enlève le 8000$. La vraie subventions est donc de 6400$ ou quelque chose proche de ça.

Voilà pour l'instant. Tu auras d'autres replies des membres pour compléter mes infos
Nissan Leaf 2014 SL Premium powered by Hydro-Québec. En route vers les 300 000 km.
Kia Soul 2019 EV Luxury comme 2ième VÉ dans la cour (en attendant la Tesla).

Avatar du membre
Stéphane Bourque
Membre assidu
Membre assidu
Messages : 445
Enregistré le : jeu. déc. 17, 2015 8:55 am

Re: Futur intéressé, Quelques questions...

Message par Stéphane Bourque » dim. mars 10, 2019 10:06 pm

Je ne suis pas certain d’avoir bien saisi la distance pour le travail moi non plus. J’ai interprété comme 2 x 30 km = 60 km. Donc avec un 50 km en bonus vous auriez besoin de 110 km de temps en temps?

Une règle du pouce veut que l’on perde 30% d’autonomie pendant l’hiver, 40% par grand froid et 50% dans les cas extrêmes. Ce n’est pas absolu comme chiffre mais ça donne une idée. La Leaf est une voiture susceptible de combler la majorité de vos besoins du quotidien mais si l’idée de devoir recharger pendant 45 minutes lors de vos longs déplacements, vous irrite, la Volt serait peut-être mieux appropriée.

Vous pouvez faire installer une prise de 240V à partir du panneau électrique de votre appartement. Il faut s’assurer que le panneau électrique est capable d’accueillir cette installation et que le propriétaire est d’accord pour ces travaux. Habituellement c’est à vous à payer mais comme la prise restera là après votre départ, peut-être qu’il y a moyen de négocier. Et oui, si vous déménagez, il faudra poser à nouveau une prise. Vous pouvez avoir 250$ en subvention pour la pose et 350$ pour la borne. Quand vous déménagerez, vous partirez avec la borne mais la prise électrique reste là et la pose d’une seconde prise risque de ne pas être éligible à une autre demande d’aide.

Au sujet de l’incitatif de 8000$, il est en vigueur jusqu’au 31 décembre 2020. Après, rien n’est encore décidé. Vous obtenez l’aide après l’application des taxes. Cette aide s‘applique aux voitures 100% électriques ainsi que pour la Volt.

Pour le chalet, vous pouvez recharger avec une borne portative 120V. Lorsque vous êtes en visite, il y a probablement une borne publique à proximité. Si vous n’avez pas le temps de recharger complètement avec une Volt, ce n’est pas grave car votre réserve d’essence vous permet de roulez sans contrainte.

Il est à noter qu’il n’y a pas de port de recharge rapide sur la Volt.

Je vous suggère de contacter des propriétaires de Leaf pour avoir leur avis sur l’autonomie et les temps de recharges. La section "essai routier" de l’AVEQ vous permettra de prendre contact avec des personnes qui ont l’expérience de ce véhicule. À noter qu’il y a des Leaf de 24, 30 et 40kWH.

Comme autre choix, la Chevrolet Bolt serait à considérer aussi.

Quote to: Windrider


Je suis très intéressé par une électrique comme prochaine voiture, j'ai donc quelques questions. (surement déjà posées par tous les futurs intéressés...)

Voici ce que je fais comme route, d"après votre expérience, est-ce bien adapté pour moi ?

Je fais 60 Km par jour pour aller travailler, en plus des quelques détours après le travail (parfois 50 km surtout l'hiver pour aller skier, donc il fait souvent en bas de - 15).

Il n'y a pas de borne au travail.

Surtout l'été, j'aime aller me promener dans les villages du Québec pour faire de la photographie ou simplement visiter, et ne pas avoir à payer de l'essence à chaque fois serait extraordinaire. En plus le roulement doux et silencieux est parfait pour la promenade les fenêtres ouvertes !

Je vais parfois voir la famille à Trois-Rivières, surtout l'hiver. Il n'y a pas de borne chez eux. Je dois donc me brancher en repartant... Un peu tannant... Je suis à Québec

Je vais plusieurs fois l'été à St-Joseph-de-la-Rive à partir de Québec. Il n'y a pas de borne au chalet, ni proche, et j'y reste parfois quelques jours.

Je dépasse rarement la limite de vitesse et je suis plutôt du genre à prendre les petites routes de campagne plutôt que les autoroutes.

Donc... :

Ça me prend une bonne autonomie, mais pas voiture la plus chère. Je crois que 200 serait correct, mais il ne faut pas que ça baisse trop en hiver. Une Leaf serait mon premier choix. Le total des paiements par mois de ma voiture à essence est plus cher que le coût d'une Leaf, mais est-ce le bon prix qui est indiqué sur le site du fabriquant ? Y'a-t-il des frais cachés etc.... ?

Le 8000$ du Gouvernement est-ce après les taxes et pour combien de temps encore ?

Ça ne me dérange pas d'arrêter quelques fois pour charger durant un plus long trajet, mais il ne faut pas que ça dure 45 minutes, et ne pas devoir chercher les bornes sans cesse et il faut qu'elles soit libres.

Il m'arrive souvent d'arriver chez moi et de repartir 30 minutes plus tard, il doit donc me rester de l'autonomie

Je suis en loyer, mais en bas. Bien situé pour mettre une borne, mais qu'arrive-t-il si je déménage? Est-ce-que que je paye un autre branchement ? Est-ce que ça doit être fait par le propriétaire du duplex?

Je fais une fois par an de plus long trajets, du genre Nouveau Brunswick, Montréal ou Magog. Quelle est votre expérience sur les long trajets ? D'après moi y'a pas de problème tant qu'il y a des bornes. En fait, je ne voie aucun inconvénient à la voiture électrique, tant qu'il y a des bornes....

Je ne suis pas très pressé pour l'instant, ma voiture sera finie de payée cet été et je vais la changer dès quelle coûtera des réparations, mais je commence à regarder car ça peux arriver plus vite qu'on crois et je pense sérieusement à une électrique.
Montérégie
Spark EV 2015

Windrider
Débutant
Débutant
Messages : 38
Enregistré le : dim. mars 10, 2019 6:11 pm

Re: Futur intéressé, Quelques questions...

Message par Windrider » dim. mars 10, 2019 10:34 pm

Return-Path:
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti1d2t14 (Cyrus 3.1.5-925-g644bf8c-fmstable-20190228v5) with LMTPA;
Sun, 10 Mar 2019 21:40:42 -0400
X-Cyrus-Session-Id: sloti1d2t14-1552268442-3491976-2-12237960317073361610
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-score: 1.3
X-Spam-hits: FREEMAIL_FROM 0.001, HTML_MESSAGE 0.001, ME_ZS_CLEAN -0.001,
RCVD_IN_DNSWL_NONE -0.0001, SPF_PASS -0.001, URI_HEX 1.313, LANGUAGES fr,
BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP='209.85.222.45', Host='mail-ua1-f45.google.com', Country='US',
FromHeader='com', MailFrom='com'
X-Spam-charsets: subject='UTF-8', to='UTF-8', plain='UTF-8', html='UTF-8'
X-Resolved-to: ml+s1097349n106146h68@n5.nabble.com
X-Delivered-to: ml+s1097349n106146h68@n5.nabble.com
X-Mail-from: icisnowkite@gmail.com
Received: from mx2 ([10.202.2.201])
by compute1.internal (LMTPProxy); Sun, 10 Mar 2019 21:40:42 -0400
Received: from mx2.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 63BCB8A0045
for ; Sun, 10 Mar 2019 21:40:41 -0400 (EDT)
Received: from mx2.messagingengine.com (localhost [127.0.0.1])
by mx2.messagingengine.com (Authentication Milter) with ESMTP
id 3935A0A0C12;
Sun, 10 Mar 2019 21:40:41 -0400
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm2; t=
1552268441; b=vQd/VRRaddpbyhmlkWoLVxjE9B1Z3CxbO+9lwEHcDAuN3Zzc6O
vQ7wrMOkHIbwNx9hIWiS0Vj66gsSSJAptmJEvs50R3/lleX0eU0F7Xv9prbCksYO
l/jB1chkmlzejvxQxAh2s4pPYIJVP3eSe9+OwHUPjxsl0kFGCCPPajxLbvuy2+mD
nyfH/LDZCNJdyCZDdrnbPlNY+77y3ijeOMmOK6t9S9DfzWjHV8qnTWzukdXyHAfh
ha5XA/fjoUWgmqjRzE5zYcoxDVDrIVRy5Ip2MXJboFB3Q30OUdYVpazYCe6JqNq6
3ZuWSEUMw6mq9a7t+6/AfTrxksRXdY5GO7Vw==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=mime-version:references:in-reply-to:from
:date:message-id:subject:to:content-type; s=fm2; t=1552268441;
bh=ow/wjpNoSYQIP7Ls2j6P5/+Lbi42ldM+VBHm9uiNwy4=; b=aJdgGV01YmvJ
E8abpXXcZ2P5Dn6sxYQvI+r1M/cO5lgAHUlXFXWdi8VSdEoGVoN42tHfeONXbr61
9yuUOzlHCF9TwyhLUJ9qzvaRV2ztW8ioqEimrK7NS4qgcxiaxA7hUtNy/ZczBueD
SHNKah+FCcAb8JIg/jR71L5MNzo/sPV8h9tk0T2Q3ws11dQwHD4gzEg9EWyNqRu7
u16clgmVNtf5D55oouQSh9g6+6Ehn/mZ1HvnQqwmfy7+8XzT+kinFQtGttWrq1jD
ZiNTh+kcNNpacAm11tLQQlkjlpZbkzSHDredohC6inM5m0Psfv9lxikeSzgv/NjG
7Hb7qNcFjQ==
ARC-Authentication-Results: i=1; mx2.messagingengine.com; arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=P0TcUZ9h header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.222.45 (mail-ua1-f45.google.com);
spf=pass smtp.mailfrom=icisnowkite@gmail.com
smtp.helo=mail-ua1-f45.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=Mua2Kms8;
x-ptr=pass smtp.helo=mail-ua1-f45.google.com
policy.ptr=mail-ua1-f45.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
Authentication-Results: mx2.messagingengine.com;
arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=P0TcUZ9h header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.222.45 (mail-ua1-f45.google.com);
spf=pass smtp.mailfrom=icisnowkite@gmail.com
smtp.helo=mail-ua1-f45.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=Mua2Kms8;
x-ptr=pass smtp.helo=mail-ua1-f45.google.com
policy.ptr=mail-ua1-f45.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
X-ME-VSSU: VW5zdWI9aHR0cDovL21lbnUtcHJpbmNpcGFsLWZvcnVtcy1hdmVxLjEwOTczNDkubjUubm
FiYmxlLmNvbS90ZW1wbGF0ZS9OYW1sU2VydmxldC5qdHA_bWFjcm89dW5zdWJzY3JpYmVf
YnlfY29kZSZub2RlPTEwNjE0MSZjb2RlPWFXTnBjMjV2ZDJ0cGRHVkFaMjFoYVd3dVkyOX
RmREV3TmpFME1Yd3pOREV5TURNeE56Zz0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedutddrgeehgdefiecutefuodetggdotefrodftvf
curfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdpuffr
tefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhepgghfjgfhff
fkuffvtgesrgdtreertddtjeenucfhrhhomhepvehhrhhishhtohhphhgvucfvihhrmhgr
nhcuoehitghishhnohifkhhithgvsehgmhgrihhlrdgtohhmqeenucffohhmrghinhepnh
grsggslhgvrdgtohhmpdgthhhrihhsthhophhhvghtihhrmhgrnhdrtghomhenucfkphep
vddtledrkeehrddvvddvrdegheenucfrrghrrghmpehinhgvthepvddtledrkeehrddvvd
dvrdeghedphhgvlhhopehmrghilhdquhgruddqfheghedrghhoohhglhgvrdgtohhmpdhm
rghilhhfrhhomhepoehitghishhnohifkhhithgvsehgmhgrihhlrdgtohhmqecuuffkkg
fgpeduleekudeknecuvehluhhsthgvrhfuihiivgeptd
X-ME-VSScore: 0
X-ME-VSCategory: clean
X-ME-ZSResult: clean
Received-SPF: pass
(gmail.com ... _spf.google.com: Sender is authorized to use 'icisnowkite@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched))
receiver=mx2.messagingengine.com;
identity=mailfrom;
envelope-from="icisnowkite@gmail.com";
helo=mail-ua1-f45.google.com;
client-ip=209.85.222.45
Received: from mail-ua1-f45.google.com (mail-ua1-f45.google.com [209.85.222.45])
(using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits))
(No client certificate requested)
by mx2.messagingengine.com (Postfix) with ESMTPS
for ; Sun, 10 Mar 2019 21:40:40 -0400 (EDT)
Received: by mail-ua1-f45.google.com with SMTP id j7so990839uak.8
for ; Sun, 10 Mar 2019 18:40:40 -0700 (PDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20161025;
h=mime-version:references:in-reply-to:from:date:message-id:subject:to;
bh=ow/wjpNoSYQIP7Ls2j6P5/+Lbi42ldM+VBHm9uiNwy4=;
b=P0TcUZ9hO3DiM7qZ44qh/AgFRfUeEHtwfdkoK2/hixqrseickwEnzEaQ9+ilYU6FJW
mjoljCLbFGrkfEpt/olzIe/e640sl37+17JsWULTcheUd7RAbIijg9qbQQZeeYrvd7Ry
UFbMjot4TDruSwkmxxIrcj9pv7nEb5tpI8R7hW/q+Eg5VQzrKXCmoyLO6kROZBmSrWP8
PtaZhQ+GwJgL7F+joBJAkbLC61SNQIuqnQd6h7VAOqJjxSuajKdAntMzCslvmp+wdxua
IWizqEAbD4U9LUyhIkoCMQ20lgs6y1eT3s86gnUKAtnVm2NWRWLpvodDGA0nfvOSMtkb
G4xA==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:mime-version:references:in-reply-to:from:date
:message-id:subject:to;
bh=ow/wjpNoSYQIP7Ls2j6P5/+Lbi42ldM+VBHm9uiNwy4=;
b=Mua2Kms8vujYqQZtR4Ba4mPpXvcVDFLH6U2UOyKFatyAygbxkH0hrVDOH87ngn0JS8
Ge/JBlRCnvup+z1K8ffXeQ31z3/cBN4PbKZxhYrqx6N/FIYDYd/MoRURm7pzA4fql5HK
vp+MutTQa8DQ+u4KW2e1Ow6h+ejYFmlhUwKTmGMRyQPEUYctqzCyoe+1Ew4HIC1eREOs
uDTZBaodxjPeZ6P2WIPTdWGobp+eo25k0kCQ3PAbTD6jGbHVY8WK2j+KRKfdKj/1m0zj
MuXTLL0k2bLHwImFvLE12QkL5070p8Wufk4BctXC+gjGCOf2CNvrTsVKRZ/6xYcvP13b
s5rQ==
X-Gm-Message-State: APjAAAWHaPeq+LVoPeUcVTWMnwPjMlqC8IoVnTqnMqWk1ZGhjBhH0AKz
PUGA647HT2uKp8W3AkfvCwfgFjMUB40V351MD7dOLQ==
X-Google-Smtp-Source: APXvYqxaqVkMazp5/HE+h1tgINR31J6gGCyHN6b+i0ydlfswyzrWSmr0iQ16OdXy0E2VFsTHvVr5mNCjrel3lVuyrYw=
X-Received: by 2002:ab0:73da:: with SMTP id m26mr14494770uaq.71.1552268438953;
Sun, 10 Mar 2019 18:40:38 -0700 (PDT)
MIME-Version: 1.0
References: <1552255074776-106141.post@n5.nabble.com> <1552266407065-106146.post@n5.nabble.com>
In-Reply-To: <1552266407065-106146.post@n5.nabble.com>
From: Christophe Tirman
Date: Sun, 10 Mar 2019 21:40:26 -0400
Message-ID:
Subject: =?UTF-8?B?UmU6IEZ1dHVyIGludMOpcmVzc8OpLCBRdWVscXVlcyBxdWVzdGlvbnMuLi4=?=
To: =?UTF-8?Q?St=C3=A9phane_Bourque_=5Bvia_Menu_principal_=2D_Forums_AV=C3=89Q=5D?=
Content-Type: multipart/alternative; boundary="000000000000e6645c0583c7a802"

--000000000000e6645c0583c7a802
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

J'oublie de mentionner, il s'agit de deux fois 30 km. 30 aller et 30 retour

Jean Christophe Tirman
418 822-4382
christophetirman.com

Le dim. 10 mars 2019 21 h 13, St=C3=A9phane Bourque [via Menu principal - F=
orums
AV=C3=89Q] a =C3=A9crit :

> Je ne suis pas certain d=E2=80=99avoir bien saisi la distance pour le tra=
vail moi
> non plus. J=E2=80=99ai interpr=C3=A9t=C3=A9 comme 2 x 30 km =3D 60 km. Do=
nc avec un 50 km en
> bonus vous auriez besoin de 110 km de temps en temps?
>
> Une r=C3=A8gle du pouce veut que l=E2=80=99on perde 30% d=E2=80=99autonom=
ie pendant l=E2=80=99hiver,
> 40% par grand froid et 50% dans les cas extr=C3=AAmes. Ce n=E2=80=99est p=
as absolu comme
> chiffre mais =C3=A7a donne une id=C3=A9e. La Leaf est une voiture suscept=
ible de
> combler la majorit=C3=A9 de vos besoins du quotidien mais si l=E2=80=99id=
=C3=A9e de devoir
> recharger pendant 45 minutes lors de vos longs d=C3=A9placements, vous ir=
rite,
> la Volt serait peut-=C3=AAtre mieux appropri=C3=A9e.
>
> Vous pouvez faire installer une prise de 240V =C3=A0 partir du panneau
> =C3=A9lectrique de votre appartement. Il faut s=E2=80=99assurer que le pa=
nneau
> =C3=A9lectrique est capable d=E2=80=99accueillir cette installation et qu=
e le
> propri=C3=A9taire est d=E2=80=99accord pour ces travaux. Habituellement c=
=E2=80=99est =C3=A0 vous =C3=A0
> payer mais comme la prise restera l=C3=A0 apr=C3=A8s votre d=C3=A9part, p=
eut-=C3=AAtre qu=E2=80=99il y
> a moyen de n=C3=A9gocier. Et oui, si vous d=C3=A9m=C3=A9nagez, il faudra =
poser =C3=A0 nouveau
> une prise. Vous pouvez avoir 250$ en subvention pour la pose et 350$ pour
> la borne. Quand vous d=C3=A9m=C3=A9nagerez, vous partirez avec la borne m=
ais la prise
> =C3=A9lectrique reste l=C3=A0 et la pose d=E2=80=99une seconde prise risq=
ue de ne pas =C3=AAtre
> =C3=A9ligible =C3=A0 une autre demande d=E2=80=99aide.
>
> Au sujet de l=E2=80=99incitatif de 8000$, il est en vigueur jusqu=E2=80=
=99au 31 d=C3=A9cembre
> 2020. Apr=C3=A8s, rien n=E2=80=99est encore d=C3=A9cid=C3=A9. Vous obtene=
z l=E2=80=99aide apr=C3=A8s
> l=E2=80=99application des taxes. Cette aide s=E2=80=98applique aux voitur=
es 100%
> =C3=A9lectriques ainsi que pour la Volt.
>
> Pour le chalet, vous pouvez recharger avec une borne portative 120V.
> Lorsque vous =C3=AAtes en visite, il y a probablement une borne publique =
=C3=A0
> proximit=C3=A9. Si vous n=E2=80=99avez pas le temps de recharger compl=C3=
=A8tement avec une
> Volt, ce n=E2=80=99est pas grave car votre r=C3=A9serve d=E2=80=99essence=
vous permet de roulez
> sans contrainte.
>
> Il est =C3=A0 noter qu=E2=80=99il n=E2=80=99y a pas de port de recharge r=
apide sur la Volt.
>
> Je vous sugg=C3=A8re de contacter des propri=C3=A9taires de Leaf pour avo=
ir leur
> avis sur l=E2=80=99autonomie et les temps de recharges. La section "essai=
routier"
> de l=E2=80=99AVEQ vous permettra de prendre contact avec des personnes qu=
i ont
> l=E2=80=99exp=C3=A9rience de ce v=C3=A9hicule. =C3=80 noter qu=E2=80=99il=
y a des Leaf de 24, 30 et 40kWH.
>
> Comme autre choix, la Chevrolet Bolt serait =C3=A0 consid=C3=A9rer aussi.
>
> Windrider wrote
> Je suis tr=C3=A8s int=C3=A9ress=C3=A9 par une =C3=A9lectrique comme proch=
aine voiture, j'ai
> donc quelques questions. (surement d=C3=A9j=C3=A0 pos=C3=A9es par tous le=
s futurs
> int=C3=A9ress=C3=A9s...)
>
> Voici ce que je fais comme route, d"apr=C3=A8s votre exp=C3=A9rience, est=
-ce bien
> adapt=C3=A9 pour moi ?
>
> Je fais 60 Km par jour pour aller travailler, en plus des quelques d=C3=
=A9tours
> apr=C3=A8s le travail (parfois 50 km surtout l'hiver pour aller skier, do=
nc il
> fait souvent en bas de - 15).
>
> Il n'y a pas de borne au travail.
>
> Surtout l'=C3=A9t=C3=A9, j'aime aller me promener dans les villages du Qu=
=C3=A9bec pour
> faire de la photographie ou simplement visiter, et ne pas avoir =C3=A0 pa=
yer de
> l'essence =C3=A0 chaque fois serait extraordinaire. En plus le roulement =
doux et
> silencieux est parfait pour la promenade les fen=C3=AAtres ouvertes !
>
> Je vais parfois voir la famille =C3=A0 Trois-Rivi=C3=A8res, surtout l'hiv=
er. Il n'y
> a pas de borne chez eux. Je dois donc me brancher en repartant... Un peu
> tannant... Je suis =C3=A0 Qu=C3=A9bec
>
> Je vais plusieurs fois l'=C3=A9t=C3=A9 =C3=A0 St-Joseph-de-la-Rive =C3=A0=
partir de Qu=C3=A9bec. Il
> n'y a pas de borne au chalet, ni proche, et j'y reste parfois quelques
> jours.
>
> Je d=C3=A9passe rarement la limite de vitesse et je suis plut=C3=B4t du g=
enre =C3=A0
> prendre les petites routes de campagne plut=C3=B4t que les autoroutes.
>
> Donc... :
>
> =C3=87a me prend une bonne autonomie, mais pas voiture la plus ch=C3=A8re=
. Je crois
> que 200 serait correct, mais il ne faut pas que =C3=A7a baisse trop en hi=
ver.
> Une Leaf serait mon premier choix. Le total des paiements par mois de ma
> voiture =C3=A0 essence est plus cher que le co=C3=BBt d'une Leaf, mais e=
st-ce le bon
> prix qui est indiqu=C3=A9 sur le site du fabriquant ? Y'a-t-il des frais =
cach=C3=A9s
> etc.... ?
>
> Le 8000$ du Gouvernement est-ce apr=C3=A8s les taxes et pour combien de t=
emps
> encore ?
>
> =C3=87a ne me d=C3=A9range pas d'arr=C3=AAter quelques fois pour charger =
durant un plus
> long trajet, mais il ne faut pas que =C3=A7a dure 45 minutes, et ne pas d=
evoir
> chercher les bornes sans cesse et il faut qu'elles soit libres.
>
> Il m'arrive souvent d'arriver chez moi et de repartir 30 minutes plus
> tard, il doit donc me rester de l'autonomie
>
> Je suis en loyer, mais en bas. Bien situ=C3=A9 pour mettre une borne, mai=
s
> qu'arrive-t-il si je d=C3=A9m=C3=A9nage? Est-ce-que que je paye un autre =
branchement
> ? Est-ce que =C3=A7a doit =C3=AAtre fait par le propri=C3=A9taire du dupl=
ex?
>
> Je fais une fois par an de plus long trajets, du genre Nouveau Brunswick,
> Montr=C3=A9al ou Magog. Quelle est votre exp=C3=A9rience sur les long tra=
jets ?
> D'apr=C3=A8s moi y'a pas de probl=C3=A8me tant qu'il y a des bornes. En f=
ait, je ne
> voie aucun inconv=C3=A9nient =C3=A0 la voiture =C3=A9lectrique, tant qu'i=
l y a des
> bornes....
>
> Je ne suis pas tr=C3=A8s press=C3=A9 pour l'instant, ma voiture sera fini=
e de pay=C3=A9e
> cet =C3=A9t=C3=A9 et je vais la changer d=C3=A8s quelle co=C3=BBtera des =
r=C3=A9parations, mais je
> commence =C3=A0 regarder car =C3=A7a peux arriver plus vite qu'on crois e=
t je pense
> s=C3=A9rieusement =C3=A0 une =C3=A9lectrique.
>
> Mont=C3=A9r=C3=A9gie
> Spark EV 2015
>
>
> ------------------------------
> Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=C3=A9 =
=C3=A0 la discussion
> ci-dessous:
>
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Futur-interesse-Q=
uelques-questions-tp106141p106146.html
> Pour vous d=C3=A9sabonner de Futur int=C3=A9ress=C3=A9, Quelques question=
s..., cliquez
> ici
> vlet.jtp?macro=3Dunsubscribe_by_code&node=3D106141&code=3DaWNpc25vd2tpdGVAZ=
21haWwuY29tfDEwNjE0MXwzNDEyMDMxNzg=3D>
> .
> NAML
> vlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml>
>

--000000000000e6645c0583c7a802
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

J'oublie de mentionner, il s'agit de deux fois 30=
km. 30 aller et 30 retour

J=
ean Christophe Tirman
418 822-4382
.com">christophetirman.com

iv dir=3D"ltr" class=3D"gmail_attr">Le dim. 10 mars 2019 21 h 13, St=C3=A9p=
hane Bourque [via Menu principal - Forums AV=C3=89Q] < ml%2Bs1097349n106146h68@n5.nabble.com">ml+s1097349n106146h68@n5.nabble.com<=
/a>> a =C3=A9crit=C2=A0:
e=3D"margin:0 0 0 .8ex;border-left:1px #ccc solid;padding-left:1ex">

Je ne suis pas certain d=E2=80=99avoir bien saisi la distance pour le trav=
ail moi non plus. J=E2=80=99ai interpr=C3=A9t=C3=A9 comme 2 x 30 km =3D 60 =
km. Donc avec un 50 km en bonus vous auriez besoin de 110 km de temps en te=
mps?


Une r=C3=A8gle du pouce veut que l=E2=80=99on perde 30% d=E2=80=99a=
utonomie pendant l=E2=80=99hiver, 40% par grand froid et 50% dans les cas e=
xtr=C3=AAmes. Ce n=E2=80=99est pas absolu comme chiffre mais =C3=A7a donne =
une id=C3=A9e. La Leaf est une voiture susceptible de combler la majorit=C3=
=A9 de vos besoins du quotidien mais si l=E2=80=99id=C3=A9e de devoir recha=
rger pendant 45 minutes lors de vos longs d=C3=A9placements, vous irrite, l=
a Volt serait peut-=C3=AAtre mieux appropri=C3=A9e.


Vous pouvez faire installer une prise de 240V =C3=A0 partir du pann=
eau =C3=A9lectrique de votre appartement. Il faut s=E2=80=99assurer que le =
panneau =C3=A9lectrique est capable d=E2=80=99accueillir cette installation=
et que le propri=C3=A9taire est d=E2=80=99accord pour ces travaux. Habitue=
llement c=E2=80=99est =C3=A0 vous =C3=A0 payer mais comme la prise restera =
l=C3=A0 apr=C3=A8s votre d=C3=A9part, peut-=C3=AAtre qu=E2=80=99il y a moye=
n de n=C3=A9gocier. Et oui, si vous d=C3=A9m=C3=A9nagez, il faudra poser =
=C3=A0 nouveau une prise. Vous pouvez avoir 250$ en subvention pour la pose=
et 350$ pour la borne. Quand vous d=C3=A9m=C3=A9nagerez, vous partirez ave=
c la borne mais la prise =C3=A9lectrique reste l=C3=A0 et la pose d=E2=80=
=99une seconde prise risque de ne pas =C3=AAtre =C3=A9ligible =C3=A0 une au=
tre demande d=E2=80=99aide.=20


Au sujet de l=E2=80=99incitatif de 8000$, il est en vigueur jusqu=
=E2=80=99au 31 d=C3=A9cembre 2020. Apr=C3=A8s, rien n=E2=80=99est encore d=
=C3=A9cid=C3=A9. Vous obtenez l=E2=80=99aide apr=C3=A8s l=E2=80=99applicati=
on des taxes. Cette aide s=E2=80=98applique aux voitures 100% =C3=A9lectriq=
ues ainsi que pour la Volt.


Pour le chalet, vous pouvez recharger avec une borne portative 120V=
. Lorsque vous =C3=AAtes en visite, il y a probablement une borne publique =
=C3=A0 proximit=C3=A9. Si vous n=E2=80=99avez pas le temps de recharger com=
pl=C3=A8tement avec une Volt, ce n=E2=80=99est pas grave car votre r=C3=A9s=
erve d=E2=80=99essence vous permet de roulez sans contrainte.


Il est =C3=A0 noter qu=E2=80=99il n=E2=80=99y a pas de port de rech=
arge rapide sur la Volt.


Je vous sugg=C3=A8re de contacter des propri=C3=A9taires de Leaf po=
ur avoir leur avis sur l=E2=80=99autonomie et les temps de recharges. La se=
ction "essai routier" de l=E2=80=99AVEQ vous permettra de prendre=
contact avec des personnes qui ont l=E2=80=99exp=C3=A9rience de ce v=C3=A9=
hicule. =C3=80 noter qu=E2=80=99il y a des Leaf de 24, 30 et 40kWH.


Comme autre choix, la Chevrolet Bolt serait =C3=A0 consid=C3=A9rer =
aussi.


lass=3D"m_2964856682576898677quote m_2964856682576898677dark-border-color">=
color">
>Windrider wrote

kable-quote">Je suis tr=C3=A8s int=C3=A9ress=C3=A9 par une =C3=A9lectrique =
comme prochaine voiture, j'ai donc quelques questions. (surement d=C3=
=A9j=C3=A0 pos=C3=A9es par tous les futurs int=C3=A9ress=C3=A9s...)


Voici ce que je fais comme route, d"apr=C3=A8s votre exp=C3=A9=
rience, est-ce bien adapt=C3=A9 pour moi ?


Je fais 60 Km par jour pour aller travailler, en plus des quelques =
d=C3=A9tours apr=C3=A8s le travail (parfois 50 km surtout l'hiver pour =
aller skier, donc il fait souvent en bas de - 15).


Il n'y a pas de borne au travail.


Surtout l'=C3=A9t=C3=A9, j'aime aller me promener dans les =
villages du Qu=C3=A9bec pour faire de la photographie ou simplement visiter=
, et ne pas avoir =C3=A0 payer de l'essence =C3=A0 chaque fois serait e=
xtraordinaire. En plus le roulement doux et silencieux est parfait pour la =
promenade les fen=C3=AAtres ouvertes !


Je vais parfois voir la famille =C3=A0 Trois-Rivi=C3=A8res, surtout=
l'hiver. Il n'y a pas de borne chez eux. Je dois donc me brancher =
en repartant... Un peu tannant... Je suis =C3=A0 Qu=C3=A9bec


Je vais plusieurs fois l'=C3=A9t=C3=A9 =C3=A0 St-Joseph-de-la-R=
ive =C3=A0 partir de Qu=C3=A9bec. Il n'y a pas de borne au chalet, ni p=
roche, et =C2=A0j'y reste parfois quelques jours.


Je d=C3=A9passe rarement la limite de vitesse et je suis plut=C3=B4=
t du genre =C3=A0 prendre les petites routes de campagne plut=C3=B4t que le=
s autoroutes.=20


Donc... :


=C3=87a me prend une bonne autonomie, mais pas voiture la plus ch=
=C3=A8re. Je crois que 200 serait correct, mais il ne faut pas que =C3=A7a =
baisse trop en hiver. Une Leaf serait mon premier choix. Le total des paiem=
ents par mois de ma voiture =C3=A0 essence est plus cher =C2=A0que le co=C3=
=BBt d'une Leaf, mais est-ce le bon prix qui est indiqu=C3=A9 sur le si=
te du fabriquant ? Y'a-t-il des frais cach=C3=A9s etc.... ?


Le 8000$ du Gouvernement est-ce apr=C3=A8s les taxes et pour combie=
n de temps encore ?


=C3=87a ne me d=C3=A9range pas d'arr=C3=AAter quelques fois pou=
r charger durant un plus long trajet, mais il ne faut pas que =C3=A7a dure =
45 minutes, et ne pas devoir chercher les bornes sans cesse et il faut qu&#=
39;elles soit libres.=20


Il m'arrive souvent d'arriver chez moi et de repartir 30 mi=
nutes plus tard, il doit donc me rester de l'autonomie


Je suis en loyer, mais en bas. Bien situ=C3=A9 pour mettre une born=
e, mais qu'arrive-t-il si je d=C3=A9m=C3=A9nage? Est-ce-que que je paye=
un autre branchement ? Est-ce que =C3=A7a doit =C3=AAtre fait par le propr=
i=C3=A9taire du duplex?


Je fais une fois par an de plus long trajets, du genre Nouveau Brun=
swick, Montr=C3=A9al ou Magog. Quelle est votre exp=C3=A9rience sur les lon=
g trajets ? D'apr=C3=A8s moi y'a pas de probl=C3=A8me tant qu'i=
l y a des bornes. En fait, je ne voie aucun inconv=C3=A9nient =C3=A0 la voi=
ture =C3=A9lectrique, tant qu'il y a des bornes....


Je ne suis pas tr=C3=A8s press=C3=A9 pour l'instant, ma voiture=
sera finie de pay=C3=A9e cet =C3=A9t=C3=A9 et je vais la changer d=C3=A8s =
quelle co=C3=BBtera des r=C3=A9parations, mais je commence =C3=A0 regarder =
car =C3=A7a peux arriver plus vite qu'on crois et je pense s=C3=A9rieus=
ement =C3=A0 une =C3=A9lectrique.




=09
=09
r:#666666;font-size:11px">
Mont=C3=A9r=C3=A9gie

Spark EV 2015










--000000000000e6645c0583c7a802--