Commander le chauffage depuis la maison

Vous vous intéressez aux voitures électriques, mais n'êtes pas convaincu? Posez vos questions ici, la communauté y répondra!

Modérateurs : StefLevert79, rpm92109, Didier Ernotte, Martin AVEQ

Répondre
Vorms
Nouveau membre
Nouveau membre
Messages : 8
Enregistré le : jeu. juin 23, 2016 9:29 am

Commander le chauffage depuis la maison

Message par Vorms » jeu. janv. 24, 2019 9:17 pm

Bonjour,
Je m'intéresse à la Leaf, Bolt et Ionic,
Je voudrais savoir si c'est possible de commander la mise en fonction du chauffage depuis la maison et par quel moyen: wifi, bluetooth, etc.
Merci pour les infos !
Thierry

Pierre L.
Membre assidu
Membre assidu
Messages : 663
Enregistré le : jeu. juin 27, 2013 6:20 pm

Re: Commander le chauffage depuis la maison

Message par Pierre L. » jeu. janv. 24, 2019 10:31 pm

La plupart des véhicules électriques ont une application cellulaire pour démarrer a distance. Donc peut fonctionner sur wifi ou réseau cellulaire.

GM et Ford ont en plus des boutons sur la clef pour démarrer a distance.
Chevrolet Bolt Premium juillet 2017
BMW i3 2014 Suite, Rex, groupe techno, jantes 20 po et19 po, avril 2017 à.....
KIA Soul EV Luxe 2016 Sept 2015 à janvier 2017
Vélo eByke SMART
Volt 2013 Oct 2012 - Sept 2015
Borne DEOT-2015-30A ASTRIA Technologies à la maison
Borne EVDUTY-40 à la maison
Borne LCS-25 ClipperCreek (SunCountry) au chalet

Vorms
Nouveau membre
Nouveau membre
Messages : 8
Enregistré le : jeu. juin 23, 2016 9:29 am

Re: Commander le chauffage depuis la maison

Message par Vorms » jeu. janv. 24, 2019 11:11 pm

Return-Path:
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti1d2t14 (Cyrus 3.1.5-766-ge2be361-fmstable-20190123v1) with LMTPA;
Thu, 24 Jan 2019 22:12:14 -0500
X-Cyrus-Session-Id: sloti1d2t14-1672174-1548385934-2-5597245128186281539
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-score: 1.3
X-Spam-hits: FREEMAIL_FROM 0.001, HTML_MESSAGE 0.001, ME_ZS_CLEAN -0.01,
RCVD_IN_DNSWL_NONE -0.0001, SPF_PASS -0.001, URI_HEX 1.313, LANGUAGES fr,
BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP='209.85.160.175', Host='mail-qt1-f175.google.com', Country='US',
FromHeader='com', MailFrom='com'
X-Spam-charsets: to='UTF-8', plain='UTF-8', html='UTF-8'
X-Resolved-to: ml+s1097349n104161h65@n5.nabble.com
X-Delivered-to: ml+s1097349n104161h65@n5.nabble.com
X-Mail-from: vormsty@gmail.com
Received: from mx2 ([10.202.2.201])
by compute1.internal (LMTPProxy); Thu, 24 Jan 2019 22:12:14 -0500
Received: from mx2.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id A6B03D933A
for ; Thu, 24 Jan 2019 22:12:13 -0500 (EST)
Received: from mx2.messagingengine.com (localhost [127.0.0.1])
by mx2.messagingengine.com (Authentication Milter) with ESMTP
id E3A467A052E;
Thu, 24 Jan 2019 22:12:13 -0500
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm1; t=
1548385933; b=AHCLVTLPy/BVf3A7N5w/BM2bRD3q603+47cLRe+f35SX0RBDVR
TSDPsSCRp/3qFevpbFwc+kdExabUEDnnpIz8clWM4AiExgjIhgcyaoixcNt6K6Ti
55BjfxwEHG2ZByNU5Tyk4IcISom9BlNCw62kmoN+2edpbFfkP8Srwj0xWJQqr0xR
WDR7LNmbvieSazhU+PNOz5zemLwMcqpxs/dzlbpnrOPLFFt/yawCdNPZxrApDc0O
QChbIguHKZBEO/YM5oA/QHFnY3zMfvWUGMhtEZjiSDpteD+Wk+57BAs5Lej+i1+q
vCEYMN9dXrKLDYizQqyNtjjwoNyubpgPARjw==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=mime-version:references:in-reply-to:from
:date:message-id:subject:to:content-type; s=fm1; t=1548385933;
bh=T5RjfBOKas1GRpCXfW3VXdprX50f8w+llurXVKouAYA=; b=tlGzWC8yTohV
a+RkHL91mI/CRNU4UaW9z+VG+SZPNxrChYYiUI5Dube07INPN/rpgSSTIiHxdqki
s01RpdNgltHVRpsFIcWUsBklpO9QEBIb4h546iEFKJQjKxhQTqWs5Sm3YEJywzse
vGewhwdGkF/CJCn1YwUESQKRXLmIfVUOVtF+kOPxPYzmL7Q3tXPT20EC901DN8jw
ouIpaScCnTPyFbyOT4otBDxnakYr4wvG88LnRgw72v+7TeoYuGKr6mEt3QT/0b6F
S34oLrlGyMMdD17LGAdFJC0wAd0qicwLOuo3a3dFZGZZOL3jonNfmVeWoOVeVKsr
eVtQUyqf4w==
ARC-Authentication-Results: i=1; mx2.messagingengine.com; arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=DRpiiCb2 header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.160.175 (mail-qt1-f175.google.com);
spf=pass smtp.mailfrom=vormsty@gmail.com
smtp.helo=mail-qt1-f175.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=Qud9NlCq;
x-ptr=pass smtp.helo=mail-qt1-f175.google.com
policy.ptr=mail-qt1-f175.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
Authentication-Results: mx2.messagingengine.com;
arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=DRpiiCb2 header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.160.175 (mail-qt1-f175.google.com);
spf=pass smtp.mailfrom=vormsty@gmail.com
smtp.helo=mail-qt1-f175.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=Qud9NlCq;
x-ptr=pass smtp.helo=mail-qt1-f175.google.com
policy.ptr=mail-qt1-f175.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
X-ME-VSSU: VW5zdWI9aHR0cDovL21lbnUtcHJpbmNpcGFsLWZvcnVtcy1hdmVxLjEwOTczNDkubjUubm
FiYmxlLmNvbS90ZW1wbGF0ZS9OYW1sU2VydmxldC5qdHA_bWFjcm89dW5zdWJzY3JpYmVf
YnlfY29kZSZub2RlPTEwNDE1NyZjb2RlPWRtOXliWE4wZVVCbmJXRnBiQzVqYjIxOE1UQT
BNVFUzZkRReU1ERTVNVEEzT1E9PQ
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedtledrieefgdehjecutefuodetggdotefrodftvf
curfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgenuceu
rghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhfffkffuvfgtsegrtderredttd
ejnecuhfhrohhmpefvhhhivghrrhihucggohhrmhhsuceovhhorhhmshhthiesghhmrghi
lhdrtghomheqnecuffhomhgrihhnpehnrggssghlvgdrtghomhenucfkphepvddtledrke
ehrdduiedtrddujeehnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrudeitddrudej
hedphhgvlhhopehmrghilhdqqhhtuddqfhdujeehrdhgohhoghhlvgdrtghomhdpmhgrih
hlfhhrohhmpeeovhhorhhmshhthiesghhmrghilhdrtghomhequcfukfgkgfepkedtvddt
necuvehluhhsthgvrhfuihiivgeptd
X-ME-VSCategory: clean
X-ME-ZSResult: clean
Received-SPF: pass
(gmail.com ... _spf.google.com: Sender is authorized to use 'vormsty@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched))
receiver=mx2.messagingengine.com;
identity=mailfrom;
envelope-from="vormsty@gmail.com";
helo=mail-qt1-f175.google.com;
client-ip=209.85.160.175
Received: from mail-qt1-f175.google.com (mail-qt1-f175.google.com [209.85.160.175])
(using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits))
(No client certificate requested)
by mx2.messagingengine.com (Postfix) with ESMTPS
for ; Thu, 24 Jan 2019 22:12:13 -0500 (EST)
Received: by mail-qt1-f175.google.com with SMTP id t33so9260390qtt.4
for ; Thu, 24 Jan 2019 19:12:13 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20161025;
h=mime-version:references:in-reply-to:from:date:message-id:subject:to;
bh=T5RjfBOKas1GRpCXfW3VXdprX50f8w+llurXVKouAYA=;
b=DRpiiCb2GdHz4qIELtHhcCIPJqm6Q4RnBqtJpAzcJqGsWkcjigkCs8yRzzH2gEkNHR
YsStHns8ExbGvSev4RmCWHcXiw1eIK2+tgUO5jgwwp7yeWDPCNmJP5oNb3oBAxFRCBSv
lj70NEMj7dJw6yGMjTaJc73yK5bhZVnNzeK1Wz9MUvxDwQ4IFxRmDHu3wkimaUDkwSdM
ZyVpDhmSj+l/JUWGIcwl3sWZEn2jN++8P8JUw8rgSppcvSOVe95OhYV22y0y0kiAB9bw
UQIFhsY8zANUXQ6X6ydp4Ous2BbELPB96PhRcxqZH/BjIB+0rmCguwiAVaLLP7BFZ3E+
9x6g==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:mime-version:references:in-reply-to:from:date
:message-id:subject:to;
bh=T5RjfBOKas1GRpCXfW3VXdprX50f8w+llurXVKouAYA=;
b=Qud9NlCqT3oTG9f6Ccck4wwZucPqGXUiSd/XrCeuXbAS1TAlETchhE6nesLjwNWMp3
qbg8COtraN6pOR9rme7J6PtvlciPaEkzXHH8jnI/qgbdhqMDYViIABYa++SvtgQ2rQuj
3xNtUS/sObKV5YCi9tocSp/yWHFy2xD4KQO82lWdoGvN6o9EGk//7fboOdZm1sK6M5ir
dB2bIPYR6x/sqqB4gIREiItl35sH/arFIQBPloA7VhI9gVpYE+FfGbnGFxKItiI31tk8
Oook/S4Vdqwqhs4fmGmojENqhucwLDf14hnJkBgL8wwFFu3tGD2FGXRzDXnoy11S7Rue
4kNQ==
X-Gm-Message-State: AJcUukcURU2J5+PghMQvbXk+ZizvM6yDG+zGC4acUXdnr2MeFtzNgfjg
SNyI44+PpeT3NRyf9vxVrvHEeey9B1ixXXjbwPuY3A==
X-Google-Smtp-Source: ALg8bN5tz13uviLPlsY8eWPLQVVMEEZK65nHx2a9T7LUd2JrQTQjfkZiLR5GYRwDc49GuZ/Gqn4UUUG6/l0m3UaDkdQ=
X-Received: by 2002:a0c:b11a:: with SMTP id q26mr8724887qvc.2.1548385931572;
Thu, 24 Jan 2019 19:12:11 -0800 (PST)
MIME-Version: 1.0
References: <1548379032669-104157.post@n5.nabble.com> <1548383515009-104161.post@n5.nabble.com>
In-Reply-To: <1548383515009-104161.post@n5.nabble.com>
From: Thierry Vorms
Date: Thu, 24 Jan 2019 22:11:59 -0500
Message-ID:
Subject: Re: Commander le chauffage depuis la maison
To: =?UTF-8?Q?Pierre_L=2E_=5Bvia_Menu_principal_=2D_Forums_AV=C3=89Q=5D?=
Content-Type: multipart/alternative; boundary="0000000000006d3a6b05803fb1c4"

--0000000000006d3a6b05803fb1c4
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Bonsoir et merci pour les informations.
Que veux dire d=C3=A9marrage a distance pour un v=C3=A9hicule =C3=A9lectriq=
ue? J'ai vu
cela dans la documentation et je me suis demand=C3=A9!
Meilleures salutations Thierry Vorms

Thierry Vorms Saint-Cyrille-de-Lessard G0R 2W0

Le jeu. 24 janv. 2019 21 h 32, Pierre L. [via Menu principal - Forums AV=C3=
=89Q]
a =C3=A9crit :

> La plupart des v=C3=A9hicules =C3=A9lectriques ont une application cellul=
aire pour
> d=C3=A9marrer a distance. Donc peut fonctionner sur wifi ou r=C3=A9seau c=
ellulaire.
>
> GM et Ford ont en plus des boutons sur la clef pour d=C3=A9marrer a dista=
nce.
>
> Chevrolet Bolt Premium juillet 2017
> BMW i3 2014 Suite, Rex, groupe techno, jantes 20 po et19 po, avril 2017
> =C3=A0.....
> KIA Soul EV Luxe 2016 Sept 2015 =C3=A0 janvier 2017
> V=C3=A9lo eByke SMART
> Volt 2013 Oct 2012 - Sept 2015
> Borne DEOT-2015-30A ASTRIA Technologies =C3=A0 la maison
> Borne EVDUTY-40 =C3=A0 la maison
> Borne LCS-25 ClipperCreek (SunCountry) au chalet
>
>
> ------------------------------
> Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=C3=A9 =
=C3=A0 la discussion
> ci-dessous:
>
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Commander-le-chau=
ffage-depuis-la-maison-tp104157p104161.html
> Pour vous d=C3=A9sabonner de Commander le chauffage depuis la maison, cli=
quez
> ici
> vlet.jtp?macro=3Dunsubscribe_by_code&node=3D104157&code=3Ddm9ybXN0eUBnbWFpb=
C5jb218MTA0MTU3fDQyMDE5MTA3OQ=3D=3D>
> .
> NAML
> vlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml>
>

--0000000000006d3a6b05803fb1c4
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Bonsoir et merci pour les informations.
=
Que veux dire d=C3=A9marrage a distance pour un v=C3=A9hicule =C3=A9lectriq=
ue? J'ai vu cela dans la documentation et je me suis demand=C3=A9! >
Meilleures salutations Thierry Vorms

artmail=3D"gmail_signature" dir=3D"auto">Thierry Vorms Saint-Cyrille-de-Les=
sard G0R 2W0

r">Le jeu. 24 janv. 2019 21 h 32, Pierre L. [via Menu principal - Forums AV=
=C3=89Q] <ml+s1=
097349n104161h65@n5.nabble.com
> a =C3=A9crit=C2=A0:
uote class=3D"gmail_quote" style=3D"margin:0 0 0 .8ex;border-left:1px #ccc =
solid;padding-left:1ex">

La plupart des v=C3=A9hicules =C3=A9lectriques ont une application cellula=
ire pour d=C3=A9marrer a distance. Donc peut fonctionner sur wifi ou r=C3=
=A9seau cellulaire.=20


GM et Ford ont en plus des boutons sur la clef pour d=C3=A9marrer a=
distance.=20




=09
=09
or:#666666;font-size:11px">
Chevrolet Bolt Premium juillet 2017

BMW i3 2014 Suite, Rex, groupe techno, jantes 20 po et19 po, avril 2017=
=C3=A0.....

KIA Soul EV Luxe 2016 Sept 2015 =C3=A0 janvier 2017

V=C3=A9lo eByke SMART

Volt 2013 Oct 2012 - Sept 2015

Borne DEOT-2015-30A ASTRIA Technologies =C3=A0 la maison

Borne EVDUTY-40 =C3=A0 la maison

Borne LCS-25 ClipperCreek (SunCountry) au chalet










--0000000000006d3a6b05803fb1c4--

lutin_numero_un
Membre régulier
Membre régulier
Messages : 278
Enregistré le : mar. mars 10, 2015 3:07 pm

Re: Commander le chauffage depuis la maison

Message par lutin_numero_un » ven. janv. 25, 2019 3:20 am

LEAF, Modèle SV et SL, sont équipées d'un module de communication cellulaire et le service est inclus avec l'achat de la voiture. Une application sur téléphone permet le contrôle de la charge et de la climatisation/chauffage.

La Bolt, c'est semblable, sur tous les modèles. De plus, à distance de télécommande, genre 100', vous pouvez démarrer climatisation et chauffage.

Ioniq, impossible, au Canada. Mais dans d'autres marchés, c'est comme la LEAF.

Martin
de Gatineau
0 voiture électrique, mais un jour....
Le jour, c'était le 18 mai 2015: Leaf SL 2013 !!
Et Tesla 3 SR+ le 4 octobre 2019 !!!

Benoit Deslauriers
Membre Elite
Membre Elite
Messages : 1723
Enregistré le : mer. oct. 05, 2016 11:33 am

Re: Commander le chauffage depuis la maison

Message par Benoit Deslauriers » ven. janv. 25, 2019 7:56 am

Quote to: Vorms


Bonsoir et merci pour les informations.
Que veux dire démarrage a distance pour un véhicule électrique? J'ai vu
cela dans la documentation et je me suis demandé!
Meilleures salutations Thierry Vorms



Ça veut simplement dire partir le chauffage/climatisation
Benoit Deslauriers
Chevrolet Spark EV noire 38 000 ekm
Nissan Leaf SV 2016 rouge 52 000 ekm
Borne EvDuty 30A première génération

Répondre

Retourner vers « Questions de futurs propriétaires »