Programmation préchauffage Leaf 2016 30kw

Vous avez un VÉ, et avez des questions? C'est ici!

Modérateurs : StefLevert79, rpm92109, Didier Ernotte, Martin AVEQ

Carole T
Nouveau membre
Nouveau membre
Messages : 5
Enregistré le : ven. févr. 01, 2019 8:59 am

Programmation préchauffage Leaf 2016 30kw

Message par Carole T » ven. févr. 01, 2019 9:04 am

Bonjour,
Quelqu’un peut m’aider? J’essaie de programmer l’auto pour avoir une charge pleine au départ de la maison (recharge sur borne L2). Le technicien NIssan m’a fait une suggestion qui ne semble pas fonctionner (charge programmée pour terminer à 7h20 et chauffage programmé pour etre complet à 7h20). Après 2 essais je suis partie à 95% un matin et 87% l’autre. Je serais supposée prendre l’énergie de la borne de la maison et non de l’auto puisque je suis branchée...Help pléiade!
Nissan Leaf 2016 30 KW Californienne

Benoit Deslauriers
Membre Elite
Membre Elite
Messages : 1723
Enregistré le : mer. oct. 05, 2016 11:33 am

Re: Programmation préchauffage Leaf 2016 30kw

Message par Benoit Deslauriers » ven. févr. 01, 2019 9:21 am

Ouinnn bin votre vendeur vous a joué un bien vilain tour.....

S'il fait froid (et c'est ce qui se passe ces jours-ci) et que la Leaf couche dehors le chauffage va partir pas mal plus tôt pour arriver à chauffer le véhicule. Comme l'heure de fin de recharge est à la même heure que l'heure de fin de chauffage un va jouer dans le plate bande de l'autre...

Exemple... il faut -20... la Leaf estime qu'il faut partir le chauffage à 6H50 pour avoir la température requise... mais à 6H50 votre voiture est chargé seulement à 95% par exemple... le chauffage prends l'énergie de la batterie et non celle de la borne... et comme il fait -20 c'est le chauffage résistif qui fonctionne à environ 4 kW de puissance alors qu'il en rentre 6.6 kw... faut êtes donc en train de charge a un faible taux de 2.6 kW... donc normal que votre véhicule perde plus.

Au contraire s'il fait -5 disons la Leaf va partir son chauffage beaucoup plus tard car le différentiel de température est moindre.... et utilisera la thermo pompe qui tire environ 1.5 kW versus le 4 kW du résistif... Donc la voiture sera chargé plus haute...

En passant même à 100% de charge c'est normal de partir quelques fois avec un 98-97% de charge quand le chauffage s'active
Benoit Deslauriers
Chevrolet Spark EV noire 38 000 ekm
Nissan Leaf SV 2016 rouge 52 000 ekm
Borne EvDuty 30A première génération

Benoit Deslauriers
Membre Elite
Membre Elite
Messages : 1723
Enregistré le : mer. oct. 05, 2016 11:33 am

Re: Programmation préchauffage Leaf 2016 30kw

Message par Benoit Deslauriers » ven. févr. 01, 2019 9:24 am

Personnellement j'aime mieux mettre une heure de départ de la charge plutôt qu'une heure de fin. La Leaf 30 kW charge complètement en environ 5 heures (j'ai aussi une 30 kWh). J'ai donc programmé la recharge pour débuter à 23H30... comme ça si elle est complètement vide elle sera pleine aux alentour de 5H00-5H30 et ma femme quitte vers 6H20... ça laisse donc du temps en masse pour le chauffage. Si elle est moins pleine bin elle sera à 100% plus aux alentour de 2 ou 3 heure du matin. Ce n'Est pas tellement grave de laisser la batterie pleine quelques heures.
Benoit Deslauriers
Chevrolet Spark EV noire 38 000 ekm
Nissan Leaf SV 2016 rouge 52 000 ekm
Borne EvDuty 30A première génération

Carole T
Nouveau membre
Nouveau membre
Messages : 5
Enregistré le : ven. févr. 01, 2019 8:59 am

Re: Programmation préchauffage Leaf 2016 30kw

Message par Carole T » ven. févr. 01, 2019 10:12 am

Return-Path:
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti1d2t14 (Cyrus 3.1.5-832-gba113d7-fmstable-20190201v1) with LMTPA;
Fri, 01 Feb 2019 09:14:31 -0500
X-Cyrus-Session-Id: sloti1d2t14-1549030471-2032305-2-16618395710725537296
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-score: 1.3
X-Spam-hits: FREEMAIL_FROM 0.001, HTML_MESSAGE 0.001, ME_ZS_CLEAN -0.001,
RCVD_IN_DNSWL_NONE -0.0001, SPF_PASS -0.001, URI_HEX 1.313, LANGUAGES fr,
BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP='209.85.219.181', Host='mail-yb1-f181.google.com', Country='US',
FromHeader='com', MailFrom='com'
X-Spam-charsets: subject='UTF-8', to='UTF-8', plain='UTF-8', html='UTF-8'
X-Resolved-to: ml+s1097349n104525h35@n5.nabble.com
X-Delivered-to: ml+s1097349n104525h35@n5.nabble.com
X-Mail-from: gestionereconseils@gmail.com
Received: from mx6 ([10.202.2.205])
by compute1.internal (LMTPProxy); Fri, 01 Feb 2019 09:14:31 -0500
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 5B665425A8
for ; Fri, 1 Feb 2019 09:14:30 -0500 (EST)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mx6.messagingengine.com (Authentication Milter) with ESMTP
id 44A56B8AA58;
Fri, 1 Feb 2019 09:14:30 -0500
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm1; t=
1549030470; b=R+IrkORSuA/epacLEb7RjaF1XdY99s0CHD33EubUQofVMcEQOd
mIRYCa5TNgBM1ehqPO+ziva2OTBRK/oMwLT7xmTkcqLqM0wj3C+DrppZ29sk5k1p
idGg+28OLvhg1dmzPEOvpeIorS+PH5MoZKjFMOPxeM1owmlWTlK4Q18xVkmeF7Lr
/Owq9gmcd8sUUyUKx7cgS5xSJ+smozWtwhCZFV0hIoGWwWm9/3JEpM+ZuwiN3opt
liDKtABoRTmeCy7gdm4xbCpCc4IKTBUCTidU0YXYooqlGWPVxeS2jOd58BclC/vH
lVhOM1/y5JZa0YggLIQMgpcI7kh54OutKt+Q==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=mime-version:references:in-reply-to:from
:date:message-id:subject:to:content-type; s=fm1; t=1549030470;
bh=SJWqjUOPkVGLJ2lpgei/1ZqLLLXk7sOUZlOPEZ0Sw3w=; b=cJBgSRI9EFz+
pPn3R06sqXe2Srxip2F8O18EuViRJc9KEp9o/k2vqB3JiE17kol9X9bDFXuuMSo8
5y5LqRdgKvwTaR+K1Hd6Gn+8t01MrSLR3UTPKvBeqtMAA2i6xJz7YCVyKuj0z9Mg
52XIXlR5byaOOYaS8r+eShH87YfoQ+BQJK3vSo6L2svpFaQSAjrkOSHrTrsAEDGr
XxT/bzhHmThk3uLB4sJOuERbCzTzGFpaIyzIi8mcf1XQrb0fPJEkgZpkg5NgmoI/
tWNoTJautrkvCloZAS8EWqdOaa4rsuyj8aKubdHAcFHbH96xFNShHlXnvHEC/0rM
5zz6uGQkkw==
ARC-Authentication-Results: i=1; mx6.messagingengine.com; arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=Fng09ty3 header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.219.181 (mail-yb1-f181.google.com);
spf=pass smtp.mailfrom=gestionereconseils@gmail.com
smtp.helo=mail-yb1-f181.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=OpiS3M8R;
x-ptr=pass smtp.helo=mail-yb1-f181.google.com
policy.ptr=mail-yb1-f181.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
Authentication-Results: mx6.messagingengine.com;
arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=Fng09ty3 header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.219.181 (mail-yb1-f181.google.com);
spf=pass smtp.mailfrom=gestionereconseils@gmail.com
smtp.helo=mail-yb1-f181.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=OpiS3M8R;
x-ptr=pass smtp.helo=mail-yb1-f181.google.com
policy.ptr=mail-yb1-f181.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
X-ME-VSSU: VW5zdWI9aHR0cDovL21lbnUtcHJpbmNpcGFsLWZvcnVtcy1hdmVxLjEwOTczNDkubjUubm
FiYmxlLmNvbS90ZW1wbGF0ZS9OYW1sU2VydmxldC5qdHA_bWFjcm89dW5zdWJzY3JpYmVf
YnlfY29kZSZub2RlPTEwNDUxNyZjb2RlPVIyVnpkR2x2Ym1WeVpXTnZibk5sYVd4elFHZH
RZV2xzTG1OdmJYd3hNRFExTVRkOE1UWTRPRE0xTlRJMk5BPT0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedtledrjeekgdeifecutefuodetggdotefrodftvf
curfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgenuceu
rghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhfffkffuvfgtsegrtderredttd
ejnecuhfhrohhmpeevrghrohhlvgcuvfhrvghprghnihgvrhcuoehgvghsthhiohhnvghr
vggtohhnshgvihhlshesghhmrghilhdrtghomheqnecuffhomhgrihhnpehlihhnkhgvug
hinhdrtghomhdpnhgrsggslhgvrdgtohhmnecukfhppedvtdelrdekhedrvdduledrudek
udenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudelrddukedupdhhvghlohepmh
grihhlqdihsgduqdhfudekuddrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomhepoehg
vghsthhiohhnvghrvggtohhnshgvihhlshesghhmrghilhdrtghomhequcfukfgkgfeple
ejjeelnecuvehluhhsthgvrhfuihiivgeptd
X-ME-VSScore: 0
X-ME-VSCategory: clean
X-ME-ZSResult: clean
Received-SPF: pass
(gmail.com ... _spf.google.com: Sender is authorized to use 'gestionereconseils@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched))
receiver=mx6.messagingengine.com;
identity=mailfrom;
envelope-from="gestionereconseils@gmail.com";
helo=mail-yb1-f181.google.com;
client-ip=209.85.219.181
Received: from mail-yb1-f181.google.com (mail-yb1-f181.google.com [209.85.219.181])
(using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits))
(No client certificate requested)
by mx6.messagingengine.com (Postfix) with ESMTPS
for ; Fri, 1 Feb 2019 09:14:29 -0500 (EST)
Received: by mail-yb1-f181.google.com with SMTP id n6so2691103ybg.8
for ; Fri, 01 Feb 2019 06:14:29 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20161025;
h=mime-version:references:in-reply-to:from:date:message-id:subject:to;
bh=SJWqjUOPkVGLJ2lpgei/1ZqLLLXk7sOUZlOPEZ0Sw3w=;
b=Fng09ty31XHju3S49nREXbZa3bW8OoK/jU3N8MI2TbKLdzqSHHbVAnzDkgbc1BwzCW
QirnXmZ/fZGo7F3iyneM4lyoeZQnmEUaNRpBeXUt4s6PuUgBc3BZioWmbc6BNHFiKGlj
T3mMTiJyI3BH7hWsSUELU/yADgb495aLf9ScdhxJK0XpyUsk4o+wYFJuEP30dKDg7NHk
coi3r1eg1zTRIecAM2kvt1fudq6Hy1+e/wj2VytCOSfjFrROlTEMFyandWpjlrkLkBdg
mxaxI7nPSgIFxG6y/XjPN9GZFEDktqEclrgI7vSALH14aBYzXz1k6Y3Ix9olFga/rWhF
ElkQ==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:mime-version:references:in-reply-to:from:date
:message-id:subject:to;
bh=SJWqjUOPkVGLJ2lpgei/1ZqLLLXk7sOUZlOPEZ0Sw3w=;
b=OpiS3M8RwioKIT0Dg4wah1ptHI+Okf6CRao0cEi2CjLpe74YuZLvhUa5MbNTfpH3Dl
evXScahpfUiGJYz/A78GfDxn5ieCsHOrL43b3vTFA4K5XOVRAgHH0jI2k7khx0DD582B
pORgYsg6iZngM84MYKt7dvG/2eOu3tLMU9eKfKTKpOqJ/KnHx1v19g4vAwppsDUvkNV2
ts1ylmRRGv8rt0JiTqQu3u7mxlCtmv+Q1lGzpRtZYHvoXKQbaI6i/z5o2FINfHvNspIp
Df+bXdOmkoGJWew9PQs82VnHPVWEhIMjreJeN/8wZ8quRaalbDTLqii1TAwTIsIFP9KG
fA9w==
X-Gm-Message-State: AHQUAuZywBGzYOiUvHqsbvT+xR72oWQEBrHbkSUxkO4S1SR8fB5PbfWf
/MHATlPylPkBdnC2KBQUHIPvKqjOGBtniJSTo2wpdw==
X-Google-Smtp-Source: AHgI3IZKndVJjg8scnNRlQbRjngZ/0hfU41bhgqG4RE6jiqCvSfuiv0BsbMHNgbx3dymmO9wSmr17AYHjER7p0N7s4o=
X-Received: by 2002:a25:df12:: with SMTP id w18mr1993330ybg.267.1549030467881;
Fri, 01 Feb 2019 06:14:27 -0800 (PST)
MIME-Version: 1.0
References: <1549026267827-104517.post@n5.nabble.com> <1549027443160-104525.post@n5.nabble.com>
In-Reply-To: <1549027443160-104525.post@n5.nabble.com>
From: Carole Trepanier
Date: Fri, 1 Feb 2019 09:22:20 -0500
Message-ID:
Subject: =?UTF-8?Q?Re=3A_Programmation_pr=C3=A9chauffage_Leaf_2016_30kw?=
To: =?UTF-8?Q?Benoit_Deslauriers_=5Bvia_Menu_principal_=2D_Forums_AV=C3=89Q=5D?=
Content-Type: multipart/alternative; boundary="000000000000c8ce550580d5c28b"

--000000000000c8ce550580d5c28b
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Donc, si je comprends bien, ce n'est pas vrai que le chauffage peut se
faire avec l'=C3=A9nergie de la borne de la maison. C'est toujours l'=C3=A9=
nergie de
la batterie de l'auto qui est utilis=C3=A9e?
*Carole Tr=C3=A9panier*, ACC, DBA
514 222-0586






Le ven. 1 f=C3=A9vr. 2019 =C3=A0 08:25, Benoit Deslauriers [via Menu princi=
pal -
Forums AV=C3=89Q] a =C3=A9crit :

> Personnellement j'aime mieux mettre une heure de d=C3=A9part de la charge
> plut=C3=B4t qu'une heure de fin. La Leaf 30 kW charge compl=C3=A8tement e=
n environ 5
> heures (j'ai aussi une 30 kWh). J'ai donc programm=C3=A9 la recharge pour
> d=C3=A9buter =C3=A0 23H30... comme =C3=A7a si elle est compl=C3=A8tement =
vide elle sera pleine
> aux alentour de 5H00-5H30 et ma femme quitte vers 6H20... =C3=A7a laisse =
donc du
> temps en masse pour le chauffage. Si elle est moins pleine bin elle sera =
=C3=A0
> 100% plus aux alentour de 2 ou 3 heure du matin. Ce n'Est pas tellement
> grave de laisser la batterie pleine quelques heures.
>
> Benoit Deslauriers
> Chevrolet Spark EV noire 38 000 ekm
> Nissan Leaf SV 2016 rouge 52 000 ekm
> Borne EvDuty 30A premi=C3=A8re g=C3=A9n=C3=A9ration
>
>
> ------------------------------
> Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=C3=A9 =
=C3=A0 la discussion
> ci-dessous:
>
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Programmation-pre=
chauffage-Leaf-2016-30kw-tp104517p104525.html
> Pour vous d=C3=A9sabonner de Programmation pr=C3=A9chauffage Leaf 2016 30=
kw, cliquez
> ici
> vlet.jtp?macro=3Dunsubscribe_by_code&node=3D104517&code=3DR2VzdGlvbmVyZWNvb=
nNlaWxzQGdtYWlsLmNvbXwxMDQ1MTd8MTY4ODM1NTI2NA=3D=3D>
> .
> NAML
> vlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml>
>

--000000000000c8ce550580d5c28b
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

,serif;font-size:small">Donc, si je comprends bien, ce n'est pas vrai q=
ue le chauffage peut se faire avec l'=C3=A9nergie de la borne de la mai=
son. C'est toujours l'=C3=A9nergie de la batterie de l'auto qui=
est utilis=C3=A9e?
ta-smartmail=3D"gmail_signature">
v>
r=3D"ltr">
>
-color:rgb(255,255,255)"> if">Carole Tr=C3=A9panier, ACC, DBA >
erif" size=3D"2">514 222-0586
=3D"2" style=3D"background-color:rgb(255,255,255)">=C2=A0
=C2=A0
>=C2=A0
<=
/div>
v>


gmail_attr">Le=C2=A0ven. 1 f=C3=A9vr. 2019 =C3=A0=C2=A008:25, Benoit Deslau=
riers [via Menu principal - Forums AV=C3=89Q] < 097349n104525h35@n5.nabble.com">ml+s1097349n104525h35@n5.nabble.com>=
a =C3=A9crit=C2=A0:
rgin:0px 0px 0px 0.8ex;border-left:1px solid rgb(204,204,204);padding-left:=
1ex">

Personnellement j'aime mieux mettre une heure de d=C3=A9part de la cha=
rge plut=C3=B4t qu'une heure de fin. La Leaf 30 kW charge compl=C3=A8te=
ment en environ 5 heures (j'ai aussi une 30 kWh). J'ai donc program=
m=C3=A9 la recharge pour d=C3=A9buter =C3=A0 23H30... comme =C3=A7a si elle=
est compl=C3=A8tement vide elle sera pleine aux alentour de 5H00-5H30 et m=
a femme quitte vers 6H20... =C3=A7a laisse donc du temps en masse pour le c=
hauffage. Si elle est moins pleine bin elle sera =C3=A0 100% plus aux alent=
our de 2 ou 3 heure du matin. Ce n'Est pas tellement grave de laisser l=
a batterie pleine quelques heures.




=09
=09
m;color:rgb(102,102,102);font-size:11px">
Benoit Deslauriers

Chevrolet Spark EV noire 38 000 ekm

Nissan Leaf SV 2016 rouge 52 000 ekm

Borne EvDuty 30A premi=C3=A8re g=C3=A9n=C3=A9ration












--000000000000c8ce550580d5c28b--
Nissan Leaf 2016 30 KW Californienne

Marcel.S
Membre Elite
Membre Elite
Messages : 1204
Enregistré le : mar. nov. 11, 2014 11:10 am
Localisation : TORONTO, ON

Re: Programmation préchauffage Leaf 2016 30kw

Message par Marcel.S » ven. févr. 01, 2019 10:19 am

Sur la Leaf 2015, le chauffage utilisait l'énergie de la batterie, et non de la maison.
Ex-Leaf SL 2015 livrée en octobre 2014
Ex-Tesla S 70D livrée le 23 septembre 2015
Tesla Modèle S 100D livrée le 29 mars 2017
Chargeur Tesla 40A 10KW
Région: Mississauga, On

Yvente
Membre Expert
Membre Expert
Messages : 2856
Enregistré le : sam. sept. 16, 2017 12:31 pm

Re: Programmation préchauffage Leaf 2016 30kw

Message par Yvente » ven. févr. 01, 2019 10:33 am

Quote to: Carole T


Donc, si je comprends bien, ce n'est pas vrai que le chauffage peut se
faire avec l'énergie de la borne de la maison. C'est toujours l'énergie de
la batterie de l'auto qui est utilisée?


Exact, c'est la batterie qui fournie le chauffage. La borne recharge cette même batterie.
Il y a donc l'intermédiaire de la batterie entre votre courant domestique et le chauffage résistif du véhicule.

Bonne idée comme mentionné plus haut de ne pas coïncider l'heure de la fin de la recharge avec l'heure de la fin du chauffage, surtout si vous avez programmé la voiture pour être un sauna à 32°C.
Nissan Leaf 2014 SL Premium powered by Hydro-Québec. En route vers les 300 000 km.
Kia Soul 2019 EV Luxury comme 2ième VÉ dans la cour (en attendant la Tesla).

Benoit Deslauriers
Membre Elite
Membre Elite
Messages : 1723
Enregistré le : mer. oct. 05, 2016 11:33 am

Re: Programmation préchauffage Leaf 2016 30kw

Message par Benoit Deslauriers » ven. févr. 01, 2019 10:42 am

Quote to: Carole T


Donc, si je comprends bien, ce n'est pas vrai que le chauffage peut se
faire avec l'énergie de la borne de la maison. C'est toujours l'énergie de
la batterie de l'auto qui est utilisée?
*Carole Trépanier*, ACC, DBA
514 222-0586



Exact....le chauffage est fournie par la batterie
Benoit Deslauriers
Chevrolet Spark EV noire 38 000 ekm
Nissan Leaf SV 2016 rouge 52 000 ekm
Borne EvDuty 30A première génération

Carole T
Nouveau membre
Nouveau membre
Messages : 5
Enregistré le : ven. févr. 01, 2019 8:59 am

Re: Programmation préchauffage Leaf 2016 30kw

Message par Carole T » ven. févr. 01, 2019 12:48 pm

Return-Path:
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti1d2t14 (Cyrus 3.1.5-832-gba113d7-fmstable-20190201v1) with LMTPA;
Fri, 01 Feb 2019 11:50:19 -0500
X-Cyrus-Session-Id: sloti1d2t14-1549039819-2322143-2-11561951384043629331
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-score: 1.3
X-Spam-hits: FREEMAIL_FROM 0.001, HTML_MESSAGE 0.001, ME_ZS_CLEAN -0.001,
RCVD_IN_DNSWL_NONE -0.0001, SPF_PASS -0.001, URI_HEX 1.313, LANGUAGES fr,
BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP='209.85.161.52', Host='mail-yw1-f52.google.com', Country='US',
FromHeader='com', MailFrom='com'
X-Spam-charsets: subject='UTF-8', to='UTF-8', plain='UTF-8', html='UTF-8'
X-Resolved-to: ml+s1097349n104534h14@n5.nabble.com
X-Delivered-to: ml+s1097349n104534h14@n5.nabble.com
X-Mail-from: gestionereconseils@gmail.com
Received: from mx6 ([10.202.2.205])
by compute1.internal (LMTPProxy); Fri, 01 Feb 2019 11:50:19 -0500
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 6FB7242136
for ; Fri, 1 Feb 2019 11:50:18 -0500 (EST)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mx6.messagingengine.com (Authentication Milter) with ESMTP
id 77DD34D61AA;
Fri, 1 Feb 2019 11:50:18 -0500
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm1; t=
1549039818; b=TysXj6RqTocPN016yOuonCf0FF+ppEV40lkfQiC1tYa2XcYBSV
Czxid1tHtQh/aewxSj69YOFeEjLpu2DwyqFVjlwimdprZeI13lnRXhAVR1wqTPip
iVxs4BH1GnvXxjnft8srr/aHBi/LdyesVw+DHAXjgZfIrWgK1cQGL/ZrJE6tIFq/
nB3RALAVjL5R77rPE2L8JQ4Duyowquz5eR23O0BKdgGn6dC5uKVTTUBIDXmhKwaq
L9fGVdGBs70u905g40lnE9SbJbSj7k2uVAvA58/BPJNk49iUBCnrPHVL9n3RtvL8
H1krBarTyOzY1AOfZIYYDYEcDaXLYsvbaTKg==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=mime-version:references:in-reply-to:from
:date:message-id:subject:to:content-type; s=fm1; t=1549039818;
bh=quyQRw5q6SBxJZNhptgf+RiKwoUW0Mh+lQa8pT6Vm+c=; b=GUyFaxGqUaxu
zNMfXfC14WnMjvDSovEiSa1nLz7evkqX6gh8ivtCl/ouvtcz755979A4X/jlKo5p
K5fPfcwXLYswlx1k+4HRZiOgm8jp7ISqzgy70niREB42zeLHConSv10MJdTxsyij
+MKrwnmBECbbSoX9j1TvNvZoR60XhN4VUaDXNYuROrIGG76VTXaPMgREjUn6odT1
PoVAUSmuSdDgW/ZXkuKeCuW/kRH0k2RRwyk9jgd/VfPUSBM6d3AtNpUa6lVNlzXO
aNrr77SZN1EEeB0sXF2Tl5Csz99rWKZNn44Ye4+v6dcLcW07cKaIspXpVhvRd9gC
dFt4qXiuVw==
ARC-Authentication-Results: i=1; mx6.messagingengine.com; arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=QWNYgSTs header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.161.52 (mail-yw1-f52.google.com);
spf=pass smtp.mailfrom=gestionereconseils@gmail.com
smtp.helo=mail-yw1-f52.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=ma1qEG/q;
x-ptr=pass smtp.helo=mail-yw1-f52.google.com
policy.ptr=mail-yw1-f52.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
Authentication-Results: mx6.messagingengine.com;
arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=QWNYgSTs header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.161.52 (mail-yw1-f52.google.com);
spf=pass smtp.mailfrom=gestionereconseils@gmail.com
smtp.helo=mail-yw1-f52.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=ma1qEG/q;
x-ptr=pass smtp.helo=mail-yw1-f52.google.com
policy.ptr=mail-yw1-f52.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
X-ME-VSSU: VW5zdWI9aHR0cDovL21lbnUtcHJpbmNpcGFsLWZvcnVtcy1hdmVxLjEwOTczNDkubjUubm
FiYmxlLmNvbS90ZW1wbGF0ZS9OYW1sU2VydmxldC5qdHA_bWFjcm89dW5zdWJzY3JpYmVf
YnlfY29kZSZub2RlPTEwNDUxNyZjb2RlPVIyVnpkR2x2Ym1WeVpXTnZibk5sYVd4elFHZH
RZV2xzTG1OdmJYd3hNRFExTVRkOE1UWTRPRE0xTlRJMk5BPT0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedtledrjeekgdelgecutefuodetggdotefrodftvf
curfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgenuceu
rghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhfffkffuvfgtsegrtderredttd
ejnecuhfhrohhmpeevrghrohhlvgcuvfhrvghprghnihgvrhcuoehgvghsthhiohhnvghr
vggtohhnshgvihhlshesghhmrghilhdrtghomheqnecuffhomhgrihhnpehlihhnkhgvug
hinhdrtghomhdpnhgrsggslhgvrdgtohhmnecukfhppedvtdelrdekhedrudeiuddrhedv
necurfgrrhgrmhepihhnvghtpedvtdelrdekhedrudeiuddrhedvpdhhvghlohepmhgrih
hlqdihfiduqdhfhedvrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpeeoghgvshht
ihhonhgvrhgvtghonhhsvghilhhssehgmhgrihhlrdgtohhmqecuuffkkgfgpedutdduud
ehnecuvehluhhsthgvrhfuihiivgeptd
X-ME-VSScore: 0
X-ME-VSCategory: clean
X-ME-ZSResult: clean
Received-SPF: pass
(gmail.com ... _spf.google.com: Sender is authorized to use 'gestionereconseils@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched))
receiver=mx6.messagingengine.com;
identity=mailfrom;
envelope-from="gestionereconseils@gmail.com";
helo=mail-yw1-f52.google.com;
client-ip=209.85.161.52
Received: from mail-yw1-f52.google.com (mail-yw1-f52.google.com [209.85.161.52])
(using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits))
(No client certificate requested)
by mx6.messagingengine.com (Postfix) with ESMTPS
for ; Fri, 1 Feb 2019 11:50:17 -0500 (EST)
Received: by mail-yw1-f52.google.com with SMTP id f65so3056548ywc.8
for ; Fri, 01 Feb 2019 08:50:17 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20161025;
h=mime-version:references:in-reply-to:from:date:message-id:subject:to;
bh=quyQRw5q6SBxJZNhptgf+RiKwoUW0Mh+lQa8pT6Vm+c=;
b=QWNYgSTsaSwdJCz9x6K60nOBaI9nc/aEhvTXGPIO/Rxs53WjQRYiCcFGWvohx5vd08
f4pyxip2h+Hkl10JgrqMgLlToS2T2hIM9CbZ04w1a9NdyFrT0HvjsT45tNHbqz8SqnCe
ZeUP+C3Qn7FiH+OVgJjP4bkxZfJq4zLBY7g5AwSfGeFC+rjbQzsLfgB1w/sPRGkqjUoo
Z5lBa9Jh7GoWDOS5v6TbGWV2aSQItYJbjUoETBuaYAY2HUAGErVHzyKg9yOmewLTJJSo
V6U2QspvBXB2auQ6RAG47bMq0//3We7kPkrB6EXWePqifyVbbMqRy4bGb3wb+PyeYxQw
XCXQ==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:mime-version:references:in-reply-to:from:date
:message-id:subject:to;
bh=quyQRw5q6SBxJZNhptgf+RiKwoUW0Mh+lQa8pT6Vm+c=;
b=ma1qEG/qJVK0B8yoxSBJwimSdO7cZkdTMac9S0krsUrjk94mATNAAO5yiYYNc/Kq3Z
mV9r7hDqxN8B+GQVAYSW7dVjwZtXOkVB6x7pvbuxlRFlt51RrOPL1lJC+1r0R9HuJ5vL
iZaq3SGarxlFcNtGqu7jZVviOqp2LY8rb2+0zB3KIsfxyLguCeR7Mk+mFVQQpBnF7Af4
5Z4hlbIxm3dVxdp7b+XrP7EJVEr8Khe5K4AOZOkc3hFHTEbAfxyraZhjB7oVhInDPUbe
tHRKSzTcnlKPfjNZIrpBtw/2ZDfjt/pPTcrFPdlC0u6fvpZbeIV16Us8kT4Lw/wEOIot
AQFQ==
X-Gm-Message-State: AJcUukd5uLm5y+3nwFOUUkJZOLSYuH59GVhNpKQS3HpUIc31rAdoVGb4
/uz7F0MdksJWpo+f2e8RQTGwzQBjXUw1+H8N5gT0JQ==
X-Google-Smtp-Source: ALg8bN7BKuWa8UxCJXEAJ5UBYY5rAL3xQ74ZbX2abfwZI2DxIceULJ9+J360dkrfQ6SWn0ONzFS4bPbWBGsUkwjYfk8=
X-Received: by 2002:a0d:c983:: with SMTP id l125mr38326528ywd.125.1549039815884;
Fri, 01 Feb 2019 08:50:15 -0800 (PST)
MIME-Version: 1.0
References: <1549026267827-104517.post@n5.nabble.com> <1549027443160-104525.post@n5.nabble.com>
<1549031630697-104534.post@n5.nabble.com>
In-Reply-To: <1549031630697-104534.post@n5.nabble.com>
From: Carole Trepanier
Date: Fri, 1 Feb 2019 11:58:08 -0500
Message-ID:
Subject: =?UTF-8?Q?Re=3A_Programmation_pr=C3=A9chauffage_Leaf_2016_30kw?=
To: =?UTF-8?Q?Yvente_=5Bvia_Menu_principal_=2D_Forums_AV=C3=89Q=5D?=
Content-Type: multipart/alternative; boundary="000000000000f805380580d7efd5"

--000000000000f805380580d7efd5
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

LOL pas de sauna chez moi! Plut=C3=B4t de 18 =C3=A0 21 degr=C3=A9s! Merci b=
eaucoup pour
vos r=C3=A9ponses!
*Carole Tr=C3=A9panier*, ACC, DBA
514 222-0586






Le ven. 1 f=C3=A9vr. 2019 =C3=A0 09:35, Yvente [via Menu principal - Forums=
AV=C3=89Q] <
ml+s1097349n104534h14@n5.nabble.com> a =C3=A9crit :

> Carole T wrote
> Donc, si je comprends bien, ce n'est pas vrai que le chauffage peut se
> faire avec l'=C3=A9nergie de la borne de la maison. C'est toujours l'=C3=
=A9nergie de
> la batterie de l'auto qui est utilis=C3=A9e?
>
> Exact, c'est la batterie qui fournie le chauffage. La borne recharge cett=
e
> m=C3=AAme batterie.
> Il y a donc l'interm=C3=A9diaire de la batterie entre votre courant domes=
tique
> et le chauffage r=C3=A9sistif du v=C3=A9hicule.
>
> Bonne id=C3=A9e comme mentionn=C3=A9 plus haut de ne pas co=C3=AFncider l=
'heure de la fin
> de la recharge avec l'heure de la fin du chauffage, surtout si vous avez
> programm=C3=A9 la voiture pour =C3=AAtre un sauna =C3=A0 32=C2=B0C.
> Nissan Leaf 2014 SL Premium powered by Hydro-Qu=C3=A9bec. En route vers l=
es 300
> 000 km.
>
>
> ------------------------------
> Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=C3=A9 =
=C3=A0 la discussion
> ci-dessous:
>
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Programmation-pre=
chauffage-Leaf-2016-30kw-tp104517p104534.html
> Pour vous d=C3=A9sabonner de Programmation pr=C3=A9chauffage Leaf 2016 30=
kw, cliquez
> ici
> vlet.jtp?macro=3Dunsubscribe_by_code&node=3D104517&code=3DR2VzdGlvbmVyZWNvb=
nNlaWxzQGdtYWlsLmNvbXwxMDQ1MTd8MTY4ODM1NTI2NA=3D=3D>
> .
> NAML
> vlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml>
>

--000000000000f805380580d7efd5
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

,serif;font-size:small">LOL pas de sauna chez moi! Plut=C3=B4t de 18 =C3=A0=
21 degr=C3=A9s! Merci beaucoup pour vos r=C3=A9ponses!
=3D"ltr" class=3D"gmail_signature" data-smartmail=3D"gmail_signature">
dir=3D"ltr">
r">
<=
div dir=3D"ltr">
=3D"ltr">
=3D"#000000">Carole =
Tr=C3=A9panier
, ACC, DBA
nt color=3D"#000000" face=3D"garamond,serif" size=3D"2">514 222-0586=
(255,255,255)">=C2=A0
;font-family:"Segoe UI","sans-serif";font-size:10pt"> href=3D"https://ca.linkedin.com/pub/carole-tr%C3%A9panier-acc-dba-pl-fin/3=
/640/71" target=3D"_blank"> none">
=
=C2=A0
=C2=A0
>
div>


mail_quote">
Le=C2=A0ven. 1 f=C3=A9vr.=
2019 =C3=A0=C2=A009:35, Yvente [via Menu principal - Forums AV=C3=89Q] <=
;ml+s1097349n10453=
4h14@n5.nabble.com
> a =C3=A9crit=C2=A0:
=3D"gmail_quote" style=3D"margin:0px 0px 0px 0.8ex;border-left:1px solid rg=
b(204,204,204);padding-left:1ex">

m" class=3D"gmail-m_-1420703021892818061quote gmail-m_-1420703021892818061d=
ark-border-color">
1420703021892818061light-border-color">
t:bold">Carole T wrote

Donc, si je compre=
nds bien, ce n'est pas vrai que le chauffage peut se

faire avec l'=C3=A9nergie de la borne de la maison. C'est toujo=
urs l'=C3=A9nergie de

la batterie de l'auto qui est utilis=C3=A9e?


Exact, c'est la batterie qui fournie le chauffage. La borne recharge ce=
tte m=C3=AAme batterie.

Il y a donc l'interm=C3=A9diaire de la batterie entre votre courant=
domestique et le chauffage r=C3=A9sistif du v=C3=A9hicule.


Bonne id=C3=A9e comme mentionn=C3=A9 plus haut de ne pas co=C3=AFnc=
ider l'heure de la fin de la recharge avec l'heure de la fin du cha=
uffage, surtout si vous avez programm=C3=A9 la voiture pour =C3=AAtre un sa=
una =C3=A0 32=C2=B0C.

=09
=09
em;color:rgb(102,102,102);font-size:11px">
Nissan Leaf 2014 SL Premium powered by Hydro-Qu=C3=A9bec. En route vers=
les 300 000 km.










--000000000000f805380580d7efd5--
Nissan Leaf 2016 30 KW Californienne

Carole T
Nouveau membre
Nouveau membre
Messages : 5
Enregistré le : ven. févr. 01, 2019 8:59 am

Re: Programmation préchauffage Leaf 2016 30kw

Message par Carole T » sam. févr. 02, 2019 6:52 pm

Return-Path:
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti1d2t14 (Cyrus 3.1.5-832-gba113d7-fmstable-20190201v1) with LMTPA;
Sat, 02 Feb 2019 17:53:54 -0500
X-Cyrus-Session-Id: sloti1d2t14-1549148034-715072-2-14219039583518326694
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-score: 1.3
X-Spam-hits: FREEMAIL_FROM 0.001, HTML_MESSAGE 0.001, ME_ZS_CLEAN -0.001,
RCVD_IN_DNSWL_NONE -0.0001, SPF_PASS -0.001, URI_HEX 1.313, LANGUAGES fr,
BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP='209.85.161.49', Host='mail-yw1-f49.google.com', Country='US',
FromHeader='com', MailFrom='com'
X-Spam-charsets: subject='UTF-8', to='UTF-8', plain='UTF-8', html='UTF-8'
X-Resolved-to: ml+s1097349n104525h35@n5.nabble.com
X-Delivered-to: ml+s1097349n104525h35@n5.nabble.com
X-Mail-from: gestionereconseils@gmail.com
Received: from mx3 ([10.202.2.202])
by compute1.internal (LMTPProxy); Sat, 02 Feb 2019 17:53:54 -0500
Received: from mx3.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 45009461DF
for ; Sat, 2 Feb 2019 17:53:54 -0500 (EST)
Received: from mx3.messagingengine.com (localhost [127.0.0.1])
by mx3.messagingengine.com (Authentication Milter) with ESMTP
id AB8409A1AC4;
Sat, 2 Feb 2019 17:53:54 -0500
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm1; t=
1549148034; b=s1Z95Rp+9YAV7wsrm6YYN6r2AA5VhUl1sPWr2OOe1AFq1PhPKZ
ShJxG3/ejme59C6lWMuo+0nae69iN29gXUfGNU9scBS13ltmxxT4E5alFt6Hp07l
iXItfnJN9uAqWkQQi22zNiV9cObnttBdL0llgtLl+cq6FvQhHRjxBBZbHeHVGmil
aRBQYD9rDKCGnBmyg4apjmxO+0k6wp0BQoy98S4UM/TTRDhSj7IXGVKVBKegh3mm
DPKALH6uWH3yD8jEVbag1gbwi3o5sf/DT5KmE1+TmryZbH08r+5tD+/qI3okNlKD
lM7Yrp+qgyDBjRvn6y4WyMltn/NWLYIssDQw==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=mime-version:references:in-reply-to:from
:date:message-id:subject:to:content-type; s=fm1; t=1549148034;
bh=dlx4FxRmYB6aSOV21+gfFxlSvWuDiiXyijb9g2LxmWw=; b=sErpYE2V+QaK
GpzhqyFYfD9lIGgaR75XK37cfDkwddmDD6el9eWx9Zizl+G5geDsKLHy19CmBkhw
t3Q91iVS7YGIZLBohnvRakV3k/1NcYJI4axcAogeOMjfwfkRxPJpN2ZUMu+wDwp9
RfNdqKBAWe08sxP5gv7yMLaMT53VNbq9+D1gB7m1cEJ27hxAP+brn64EGHW4HGOx
DW+V1H13wBij6fV9oCJFtHloNM75pXUHO4u2WkVsJdZsVk2moh+/9KzqVjZeYlP0
PoXxdVAzhAhSVX/Cd2OeB0H4Q3PROcrmm404fxaNPBTwXTZq6WvPDbJ0MEr98l5m
546LXfOLZw==
ARC-Authentication-Results: i=1; mx3.messagingengine.com; arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=SUOHRTAJ header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.161.49 (mail-yw1-f49.google.com);
spf=pass smtp.mailfrom=gestionereconseils@gmail.com
smtp.helo=mail-yw1-f49.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=YL/Lm7wN;
x-ptr=pass smtp.helo=mail-yw1-f49.google.com
policy.ptr=mail-yw1-f49.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
Authentication-Results: mx3.messagingengine.com;
arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=SUOHRTAJ header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.161.49 (mail-yw1-f49.google.com);
spf=pass smtp.mailfrom=gestionereconseils@gmail.com
smtp.helo=mail-yw1-f49.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=YL/Lm7wN;
x-ptr=pass smtp.helo=mail-yw1-f49.google.com
policy.ptr=mail-yw1-f49.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
X-ME-VSSU: VW5zdWI9aHR0cDovL21lbnUtcHJpbmNpcGFsLWZvcnVtcy1hdmVxLjEwOTczNDkubjUubm
FiYmxlLmNvbS90ZW1wbGF0ZS9OYW1sU2VydmxldC5qdHA_bWFjcm89dW5zdWJzY3JpYmVf
YnlfY29kZSZub2RlPTEwNDUxNyZjb2RlPVIyVnpkR2x2Ym1WeVpXTnZibk5sYVd4elFHZH
RZV2xzTG1OdmJYd3hNRFExTVRkOE1UWTRPRE0xTlRJMk5BPT0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedtledrkedtgddujedtucetufdoteggodetrfdotf
fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf
ffkffuvfgtsegrtderredttdejnecuhfhrohhmpeevrghrohhlvgcuvfhrvghprghnihgv
rhcuoehgvghsthhiohhnvghrvggtohhnshgvihhlshesghhmrghilhdrtghomheqnecuff
homhgrihhnpehlihhnkhgvughinhdrtghomhdpnhgrsggslhgvrdgtohhmnecukfhppedv
tdelrdekhedrudeiuddrgeelnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrudeiud
drgeelpdhhvghlohepmhgrihhlqdihfiduqdhfgeelrdhgohhoghhlvgdrtghomhdpmhgr
ihhlfhhrohhmpeeoghgvshhtihhonhgvrhgvtghonhhsvghilhhssehgmhgrihhlrdgtoh
hmqecuuffkkgfgpeelkedtjeenucevlhhushhtvghrufhiiigvpedt
X-ME-VSScore: 0
X-ME-VSCategory: clean
X-ME-ZSResult: clean
Received-SPF: pass
(gmail.com ... _spf.google.com: Sender is authorized to use 'gestionereconseils@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched))
receiver=mx3.messagingengine.com;
identity=mailfrom;
envelope-from="gestionereconseils@gmail.com";
helo=mail-yw1-f49.google.com;
client-ip=209.85.161.49
Received: from mail-yw1-f49.google.com (mail-yw1-f49.google.com [209.85.161.49])
(using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits))
(No client certificate requested)
by mx3.messagingengine.com (Postfix) with ESMTPS
for ; Sat, 2 Feb 2019 17:53:53 -0500 (EST)
Received: by mail-yw1-f49.google.com with SMTP id i23so538226ywe.10
for ; Sat, 02 Feb 2019 14:53:53 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20161025;
h=mime-version:references:in-reply-to:from:date:message-id:subject:to;
bh=dlx4FxRmYB6aSOV21+gfFxlSvWuDiiXyijb9g2LxmWw=;
b=SUOHRTAJBGb90LA7mdtFXv00FwJS9gZaMZ8ccnXjMeO79Vtr7OYGntuLlWyPutkMS8
sqj2QH6pSxS5qUVqp+c0KkFPMlTJ+FBPkCqjOZrRN99h6k1Tp/SwP4swua/QaxPWnqDp
i9p5wFhd7YhchveT9ZPqA6u3j2McdxwpLwJsCQMfqowtoP3OIcv+3s2LSkP/cMxdpt3a
JKM4AmfruTUK4AadBAb0TIprMYVE0FDYUA7OTrpgGtydE1YZceucSMiGowhkUDhU/V16
eUY5187WNhaT6I2YnSJJZtBSoofpTnWDeG2tQ35htziRbebgzdh1c548WrSUZAAPwf/X
21Yw==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:mime-version:references:in-reply-to:from:date
:message-id:subject:to;
bh=dlx4FxRmYB6aSOV21+gfFxlSvWuDiiXyijb9g2LxmWw=;
b=YL/Lm7wNS0DJotb8eAg+7KZ43dxbM+V6I1LOXIEr1E5ScT9J3snYaZBMTv0IAo5z++
PrQz0OFs6uOxF/xq2PMTeAorh8EPOrmezmp3IWxNYzADhy2n1GIWDZ1J6Ssk3mE6EIXG
BqmLAzmy0JDnWUTh8cXuqOXUrzgjb9IV29pPSi1NqvjO9NBn4iLpX9APJ1sz9t/+x/R9
7EArV97RezQjDAY60OHvkQFSoBnIM48AOV/g2qTUyRFLQuTl15lfS+ym1jpaxYQGlSDu
dC2zPnW6fyYMjYxjSqlbtM8LA9h+m7v7aOhk3r5yO9F6SqELauh/EozhaZOcJRWY4t6v
Lgmg==
X-Gm-Message-State: AHQUAuZ9m4et/iXCsIhp4zCyp/crbThe+27JjHCuiIQJUuWz9Vlsbh8T
ber3iWJwhb6fC2fzgoLJEXEr3okjditRjzZDfevAew==
X-Google-Smtp-Source: AHgI3Ia8RlI8kEwSa3EknKbjpC+Tc82IVy9/x9j6es9480uZFXpUobY9+h6B7orsqLL2tEmnN1LQG2XN93y4zI5iP2U=
X-Received: by 2002:a81:1dc3:: with SMTP id d186mr2769707ywd.11.1549148031699;
Sat, 02 Feb 2019 14:53:51 -0800 (PST)
MIME-Version: 1.0
References: <1549026267827-104517.post@n5.nabble.com> <1549027443160-104525.post@n5.nabble.com>
In-Reply-To: <1549027443160-104525.post@n5.nabble.com>
From: Carole Trepanier
Date: Sat, 2 Feb 2019 17:53:40 -0500
Message-ID:
Subject: =?UTF-8?Q?Re=3A_Programmation_pr=C3=A9chauffage_Leaf_2016_30kw?=
To: =?UTF-8?Q?Benoit_Deslauriers_=5Bvia_Menu_principal_=2D_Forums_AV=C3=89Q=5D?=
Content-Type: multipart/alternative; boundary="0000000000002253010580f122ed"

--0000000000002253010580f122ed
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Bonsoir Benoit, quel est l=E2=80=99avantage de faire cela plut=C3=B4t que d=
e la charger
d=C3=A8s qu=E2=80=99on branche l=E2=80=99auto? Si j=E2=80=99ai bien compri=
s, lorsque le chauffage va
partir le lendemain matin, il va prendre l=E2=80=99=C3=A9nergie de la batte=
rie de la
meme fa=C3=A7on...

Le ven. 1 f=C3=A9vr. 2019 =C3=A0 08:25, Benoit Deslauriers [via Menu princi=
pal -
Forums AV=C3=89Q] a =C3=A9crit :

> Personnellement j'aime mieux mettre une heure de d=C3=A9part de la charge
> plut=C3=B4t qu'une heure de fin. La Leaf 30 kW charge compl=C3=A8tement e=
n environ 5
> heures (j'ai aussi une 30 kWh). J'ai donc programm=C3=A9 la recharge pour
> d=C3=A9buter =C3=A0 23H30... comme =C3=A7a si elle est compl=C3=A8tement =
vide elle sera pleine
> aux alentour de 5H00-5H30 et ma femme quitte vers 6H20... =C3=A7a laisse =
donc du
> temps en masse pour le chauffage. Si elle est moins pleine bin elle sera =
=C3=A0
> 100% plus aux alentour de 2 ou 3 heure du matin. Ce n'Est pas tellement
> grave de laisser la batterie pleine quelques heures.
>
> Benoit Deslauriers
> Chevrolet Spark EV noire 38 000 ekm
> Nissan Leaf SV 2016 rouge 52 000 ekm
> Borne EvDuty 30A premi=C3=A8re g=C3=A9n=C3=A9ration
>
>
> ------------------------------
> Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=C3=A9 =
=C3=A0 la discussion
> ci-dessous:
>
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Programmation-pre=
chauffage-Leaf-2016-30kw-tp104517p104525.html
> Pour vous d=C3=A9sabonner de Programmation pr=C3=A9chauffage Leaf 2016 30=
kw, cliquez
> ici
> vlet.jtp?macro=3Dunsubscribe_by_code&node=3D104517&code=3DR2VzdGlvbmVyZWNvb=
nNlaWxzQGdtYWlsLmNvbXwxMDQ1MTd8MTY4ODM1NTI2NA=3D=3D>
> .
> NAML
> vlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml>
>
--=20
*Carole Tr=C3=A9panier*, ACC, DBA
514 222-0586



--0000000000002253010580f122ed
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Bonsoir Benoit, quel est l=E2=80=99avantage de faire=
cela plut=C3=B4t que de la charger d=C3=A8s =C2=A0qu=E2=80=99on branche l=
=E2=80=99auto? Si j=E2=80=99ai bien compris, lorsque le chauffage va partir=
le lendemain matin, il va prendre l=E2=80=99=C3=A9nergie de la batterie de=
la meme fa=C3=A7on...

dir=3D"ltr">Le ven. 1 f=C3=A9vr. 2019 =C3=A0 08:25, Benoit Deslauriers [via=
Menu principal - Forums AV=C3=89Q] < 525h35@n5.nabble.com">ml+s1097349n104525h35@n5.nabble.com> a =C3=A9c=
rit=C2=A0:
.8ex;border-left:1px #ccc solid;padding-left:1ex">

Personnellement j'aime mieux mettre une heure de d=C3=A9part de la cha=
rge plut=C3=B4t qu'une heure de fin. La Leaf 30 kW charge compl=C3=A8te=
ment en environ 5 heures (j'ai aussi une 30 kWh). J'ai donc program=
m=C3=A9 la recharge pour d=C3=A9buter =C3=A0 23H30... comme =C3=A7a si elle=
est compl=C3=A8tement vide elle sera pleine aux alentour de 5H00-5H30 et m=
a femme quitte vers 6H20... =C3=A7a laisse donc du temps en masse pour le c=
hauffage. Si elle est moins pleine bin elle sera =C3=A0 100% plus aux alent=
our de 2 ou 3 heure du matin. Ce n'Est pas tellement grave de laisser l=
a batterie pleine quelques heures.




=09
=09
r:#666666;font-size:11px">
Benoit Deslauriers

Chevrolet Spark EV noire 38 000 ekm

Nissan Leaf SV 2016 rouge 52 000 ekm

Borne EvDuty 30A premi=C3=A8re g=C3=A9n=C3=A9ration










--
ature" data-smartmail=3D"gmail_signature">
"ltr">
v>
r=3D"ltr">
ackground-color:rgb(255,255,255)"> amond,serif">Carole Tr=C3=A9panier, ACC, =
DBA
aramond,serif" size=3D"2">514 222-0586
000" size=3D"2" style=3D"background-color:rgb(255,255,255)">=C2=A0 div>
=C2=A0
ze=3D"1">=C2=A0
>
div>


--0000000000002253010580f122ed--
Nissan Leaf 2016 30 KW Californienne

Sebas
Membre assidu
Membre assidu
Messages : 668
Enregistré le : dim. sept. 03, 2017 11:46 am
Localisation : Ste thérèse

Re: Programmation préchauffage Leaf 2016 30kw

Message par Sebas » sam. févr. 02, 2019 9:14 pm

Quote to: Carole T


Bonsoir Benoit, quel est l’avantage de faire cela plutôt que de la charger
dès qu’on branche l’auto? Si j’ai bien compris, lorsque le chauffage va
partir le lendemain matin, il va prendre l’énergie de la batterie de la
meme façon...

Le ven. 1 févr. 2019 à 08:25, Benoit Deslauriers [via Menu principal -
Forums AVÉQ] <ml+s1097349n104525h35@.nabble> a écrit :

> Personnellement j'aime mieux mettre une heure de départ de la charge
> plutôt qu'une heure de fin. La Leaf 30 kW charge complètement en environ 5
> heures (j'ai aussi une 30 kWh). J'ai donc programmé la recharge pour
> débuter à 23H30... comme ça si elle est complètement vide elle sera pleine
> aux alentour de 5H00-5H30 et ma femme quitte vers 6H20... ça laisse donc du
> temps en masse pour le chauffage. Si elle est moins pleine bin elle sera à
> 100% plus aux alentour de 2 ou 3 heure du matin. Ce n'Est pas tellement
> grave de laisser la batterie pleine quelques heures.
>
> Benoit Deslauriers
> Chevrolet Spark EV noire 38 000 ekm
> Nissan Leaf SV 2016 rouge 52 000 ekm
> Borne EvDuty 30A première génération
>
>
> ------------------------------
> Si vous répondez à cet email, votre message sera ajouté à la discussion
> ci-dessous:
>
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Programmation-prechauffage-Leaf-2016-30kw-tp104517p104525.html
> Pour vous désabonner de Programmation préchauffage Leaf 2016 30kw, cliquez
> ici
> <http://menu-principal-forums-aveq.1097349.n5.nabble.com/template/NamlServlet.jtp?macro=unsubscribe_by_code&node=104517&code=R2VzdGlvbmVyZWNvbnNlaWxzQGdtYWlsLmNvbXwxMDQ1MTd8MTY4ODM1NTI2NA==>
> .
> NAML
> <http://menu-principal-forums-aveq.1097349.n5.nabble.com/template/NamlServlet.jtp?macro=macro_viewer&id=instant_html%21nabble%3Aemail.naml&base=nabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNamespace-nabble.view.web.template.NodeNamespace&breadcrumbs=notify_subscribers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant_email%21nabble%3Aemail.naml>
>
--
*Carole Trépanier*, ACC, DBA
514 222-0586

<https://ca.linkedin.com/pub/carole-tr%C3%A9panier-acc-dba-pl-fin/3/640/71>


L'avantage est que la recharge tend à réchauffer la batterie. En programmant la recharge avant votre départ, vous partez ainsi avec une batterie bien chaude et efficace.

Si vous rechargez votre batterie à votre arrivée vers les 18h, votre batterie aura le temps de refroidir et sera donc moins efficace.

Répondre

Retourner vers « Besoin d'aide »