Programmation préchauffage Leaf 2016 30kw

Vous avez un VÉ, et avez des questions? C'est ici!

Modérateurs : StefLevert79, rpm92109, Didier Ernotte, Martin AVEQ

Carole T
Nouveau membre
Nouveau membre
Messages : 5
Enregistré le : ven. févr. 01, 2019 8:59 am

Re: Programmation préchauffage Leaf 2016 30kw

Message par Carole T » sam. févr. 02, 2019 9:22 pm

Return-Path:
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti1d2t14 (Cyrus 3.1.5-832-gba113d7-fmstable-20190201v1) with LMTPA;
Sat, 02 Feb 2019 20:24:47 -0500
X-Cyrus-Session-Id: sloti1d2t14-1549157087-905848-2-6034367670573914000
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-score: 1.3
X-Spam-hits: FREEMAIL_FROM 0.001, HTML_MESSAGE 0.001, ME_ZS_CLEAN -0.001,
RCVD_IN_DNSWL_NONE -0.0001, SPF_PASS -0.001, URI_HEX 1.313, LANGUAGES fr,
BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP='209.85.161.50', Host='mail-yw1-f50.google.com', Country='US',
FromHeader='com', MailFrom='com'
X-Spam-charsets: subject='UTF-8', to='UTF-8', plain='UTF-8', html='UTF-8'
X-Resolved-to: ml+s1097349n104619h49@n5.nabble.com
X-Delivered-to: ml+s1097349n104619h49@n5.nabble.com
X-Mail-from: gestionereconseils@gmail.com
Received: from mx6 ([10.202.2.205])
by compute1.internal (LMTPProxy); Sat, 02 Feb 2019 20:24:47 -0500
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 26D4B42182
for ; Sat, 2 Feb 2019 20:24:46 -0500 (EST)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mx6.messagingengine.com (Authentication Milter) with ESMTP
id DC881D8F7E6;
Sat, 2 Feb 2019 20:24:46 -0500
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm1; t=
1549157086; b=xJopfP93Pxuvgy4vu2lrA36V3bUhGoDwfYh02X/dKR5PqduWEi
Ey1y8TSxMcL0Fv9sZrGbZBJQLCOtnYpj/ypINcfMYZn3sN715CLrTeckygOtCv2x
E7irtdnjjr3+V1OXEWElCazMCCw69CvbsnopgTnCKZxq7zJjXUhuLuEW8M+HSNQG
KwqR06czTWYMTikWqKOCJciwJEP6lQj3nstv1FYKOPTcp5A3CbDRaXbYCYribGAN
ohKbKTGXXsBAV3vYzkI2oNRWozX4z+yHKGYssgYMFjtYJp+Sv8lBQcWnwjkoW/pI
Z1rqHb/R6za6F/shJ+7mESPBnQvrLyFYPh+A==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=mime-version:references:in-reply-to:from
:date:message-id:subject:to:content-type; s=fm1; t=1549157086;
bh=1dnQ93bjucsNlucPPLsnNZ7Fv+5sWfIn+8ty/BfTRDY=; b=IJZr8Q3+0e6B
BRCJ7xOOnpxb3gYErh/JpuJ+FYtaEqtc3g5AAiIU16uE/Y271T7vkbwskkBKFZ0x
0Z1IR15fPE0UpNGLAd4/bah6moR1PRpG+rH7g1u8145fjvYCbQawVFauDotj/Woi
SCfxYvSUIurG8ew0z4sbXoPHA//LhUh8Oo+KUXR7+Vboo1gdyHrrYLNOHbxPXRtz
pVPwq1nuxzxFXo+xxR6VTx6pPABIxMAXotz9Nh3nF0+XJngMwlI4zZpi8gNH7nX8
F8fqYuvH7354CxwsOfN5FJQN5KMaYkXNOF6+lLIJryMie8IT0G3ktscHhHIcFGOt
BWHsVhBfvw==
ARC-Authentication-Results: i=1; mx6.messagingengine.com; arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=AVI4/URB header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.161.50 (mail-yw1-f50.google.com);
spf=pass smtp.mailfrom=gestionereconseils@gmail.com
smtp.helo=mail-yw1-f50.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=RdVTzuYU;
x-ptr=pass smtp.helo=mail-yw1-f50.google.com
policy.ptr=mail-yw1-f50.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
Authentication-Results: mx6.messagingengine.com;
arc=none (no signatures found);
dkim=pass (2048-bit rsa key sha256) header.d=gmail.com
header.i=@gmail.com header.b=AVI4/URB header.a=rsa-sha256
header.s=20161025 x-bits=2048;
dmarc=pass policy.published-domain-policy=none
policy.published-subdomain-policy=quarantine
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p
header.from=gmail.com;
iprev=pass smtp.remote-ip=209.85.161.50 (mail-yw1-f50.google.com);
spf=pass smtp.mailfrom=gestionereconseils@gmail.com
smtp.helo=mail-yw1-f50.google.com;
x-aligned-from=pass (Address match);
x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net
header.i=@1e100.net header.b=RdVTzuYU;
x-ptr=pass smtp.helo=mail-yw1-f50.google.com
policy.ptr=mail-yw1-f50.google.com;
x-return-mx=pass header.domain=gmail.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-GCM-SHA256
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
X-ME-VSSU: VW5zdWI9aHR0cDovL21lbnUtcHJpbmNpcGFsLWZvcnVtcy1hdmVxLjEwOTczNDkubjUubm
FiYmxlLmNvbS90ZW1wbGF0ZS9OYW1sU2VydmxldC5qdHA_bWFjcm89dW5zdWJzY3JpYmVf
YnlfY29kZSZub2RlPTEwNDUxNyZjb2RlPVIyVnpkR2x2Ym1WeVpXTnZibk5sYVd4elFHZH
RZV2xzTG1OdmJYd3hNRFExTVRkOE1UWTRPRE0xTlRJMk5BPT0
X-ME-VSSU: VW5zdWI9aHR0cDovL21lbnUtcHJpbmNpcGFsLWZvcnVtcy1hdmVxLjEwOTczNDkubjUubm
FiYmxlLmNvbS90ZW1wbGF0ZS9OYW1sU2VydmxldC5qdHA_bWFjcm89dW5zdWJzY3JpYmVf
YnlfY29kZSZub2RlPTEwNDUxNyZjb2RlPVIyVnpkR2x2Ym1WeVpXTnZibk5sYVd4elFHZH
RZV2xzTG1OdmJYd3hNRFExTVRkOE1UWTRPRE0xTlRJMk5BPT0-
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedtledrkedugddvjecutefuodetggdotefrodftvf
curfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgenuceu
rghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhfffkffuvfgtsegrtderredttd
ejnecuhfhrohhmpeevrghrohhlvgcuvfhrvghprghnihgvrhcuoehgvghsthhiohhnvghr
vggtohhnshgvihhlshesghhmrghilhdrtghomheqnecuffhomhgrihhnpehlihhnkhgvug
hinhdrtghomhdpnhgrsggslhgvrdgtohhmnecukfhppedvtdelrdekhedrudeiuddrhedt
necurfgrrhgrmhepihhnvghtpedvtdelrdekhedrudeiuddrhedtpdhhvghlohepmhgrih
hlqdihfiduqdhfhedtrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpeeoghgvshht
ihhonhgvrhgvtghonhhsvghilhhssehgmhgrihhlrdgtohhmqecuuffkkgfgpedugeeiud
dvnecuvehluhhsthgvrhfuihiivgeptd
X-ME-VSScore: 0
X-ME-VSCategory: clean
X-ME-ZSResult: clean
Received-SPF: pass
(gmail.com ... _spf.google.com: Sender is authorized to use 'gestionereconseils@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched))
receiver=mx6.messagingengine.com;
identity=mailfrom;
envelope-from="gestionereconseils@gmail.com";
helo=mail-yw1-f50.google.com;
client-ip=209.85.161.50
Received: from mail-yw1-f50.google.com (mail-yw1-f50.google.com [209.85.161.50])
(using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits))
(No client certificate requested)
by mx6.messagingengine.com (Postfix) with ESMTPS
for ; Sat, 2 Feb 2019 20:24:45 -0500 (EST)
Received: by mail-yw1-f50.google.com with SMTP id k188so4394093ywa.6
for ; Sat, 02 Feb 2019 17:24:45 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20161025;
h=mime-version:references:in-reply-to:from:date:message-id:subject:to;
bh=1dnQ93bjucsNlucPPLsnNZ7Fv+5sWfIn+8ty/BfTRDY=;
b=AVI4/URBHwwlpjL+vxs9qsfB7zZ31aCXeCnJehby480b9Cru0U8jn+1n9lHFq1xRPo
4Myp6wPAzh39Mdvsnyc3SUyJX5Gz+Z7NgSCBjzqeSL3AhxeGUSuZL9WlU8w613CTVen4
87MksBGeGoenpjwFMkRBIZnWLjBldqArhwTN78/WvVmk5ZbBD3xG4YQY9Lyfnsa1d2H6
BGyOot6gPSjS0avaaQCFY7kO9cJjv3qBRpPjxn+ahAosNxdMQG4iuN/Zf/hh+f+q6sRI
p73h9nEPHDIYk93WhwvFwy+2BqIAK9pH9lyNFBhHa9wNGKJnX0bpVy86X5xmAynW0YLK
TmDw==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:mime-version:references:in-reply-to:from:date
:message-id:subject:to;
bh=1dnQ93bjucsNlucPPLsnNZ7Fv+5sWfIn+8ty/BfTRDY=;
b=RdVTzuYUbQo8lFXzCeLbF/kRilhLNgqUIdwdIqn2xzd+Wo3Gac7rcnOA2jmpoVQXms
UYlEzT5ojDPlAKrZbWZqguBrlaEhkl4p/mUFKUVkmIooQRjimRV/SzZFBI6Qq6H44q0V
xn/2WxfCJ6BCHqUnP0AUk9ahuKHIUYW26pkfKcD9Ga9gA78NeLhv7bTcp40RXwa/hFNd
ZNU4az+cZnrmQzaH+M/9B5BrLXOY5BJJfy6M5dDOqA/wkw4JZzwJUJALDCK+kD8SgyTm
B+YGJ7rd3Dmwr/Zf5261a/odEsMM4mS+ZCYrbeHtxTPk4cagmZ7rcqalB9++uUqzphRN
9hdg==
X-Gm-Message-State: AHQUAuZPdKg2oOAWAW1RCH7yaSnRfyRw9t5a4p0FMOseLis0Aldhlc20
N+KwBEoWDKpwUgDsEcVq90ZZKC2IPml22/67uamUZg==
X-Google-Smtp-Source: AHgI3IZRJILSNns04ysaxtVt+6LRW4BAeYIOxJzHp0AkMu/xDZaMgtRVw+Zfq+kTlfiXiawvt7cfRBnKyWhWcpOIGVI=
X-Received: by 2002:a81:23d4:: with SMTP id j203mr4488760ywj.357.1549157083928;
Sat, 02 Feb 2019 17:24:43 -0800 (PST)
MIME-Version: 1.0
References: <1549026267827-104517.post@n5.nabble.com> <1549027443160-104525.post@n5.nabble.com>
<1549156485080-104619.post@n5.nabble.com>
In-Reply-To: <1549156485080-104619.post@n5.nabble.com>
From: Carole Trepanier
Date: Sat, 2 Feb 2019 20:24:32 -0500
Message-ID:
Subject: =?UTF-8?Q?Re=3A_Programmation_pr=C3=A9chauffage_Leaf_2016_30kw?=
To: =?UTF-8?Q?Sebas_=5Bvia_Menu_principal_=2D_Forums_AV=C3=89Q=5D?=
Content-Type: multipart/alternative; boundary="000000000000b05c670580f33d4e"

--000000000000b05c670580f33d4e
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

D' accord. Merci!

Carole Trepanier
514 222-0586

Le sam. 2 f=C3=A9vr. 2019 20 h 16, Sebas [via Menu principal - Forums AV=C3=
=89Q] <
ml+s1097349n104619h49@n5.nabble.com> a =C3=A9crit :

> Carole T wrote
> Bonsoir Benoit, quel est l=E2=80=99avantage de faire cela plut=C3=B4t que=
de la charger
> d=C3=A8s qu=E2=80=99on branche l=E2=80=99auto? Si j=E2=80=99ai bien comp=
ris, lorsque le chauffage va
> partir le lendemain matin, il va prendre l=E2=80=99=C3=A9nergie de la bat=
terie de la
> meme fa=C3=A7on...
>
> Le ven. 1 f=C3=A9vr. 2019 =C3=A0 08:25, Benoit Deslauriers [via Menu prin=
cipal -
> Forums AV=C3=89Q] <[hidden email]
> > a =C3=A9cri=
t :
>
> > Personnellement j'aime mieux mettre une heure de d=C3=A9part de la char=
ge
> > plut=C3=B4t qu'une heure de fin. La Leaf 30 kW charge compl=C3=A8tement=
en environ
> 5
> > heures (j'ai aussi une 30 kWh). J'ai donc programm=C3=A9 la recharge po=
ur
> > d=C3=A9buter =C3=A0 23H30... comme =C3=A7a si elle est compl=C3=A8temen=
t vide elle sera
> pleine
> > aux alentour de 5H00-5H30 et ma femme quitte vers 6H20... =C3=A7a laiss=
e donc
> du
> > temps en masse pour le chauffage. Si elle est moins pleine bin elle ser=
a
> =C3=A0
> > 100% plus aux alentour de 2 ou 3 heure du matin. Ce n'Est pas tellement
> > grave de laisser la batterie pleine quelques heures.
> >
> > Benoit Deslauriers
> > Chevrolet Spark EV noire 38 000 ekm
> > Nissan Leaf SV 2016 rouge 52 000 ekm
> > Borne EvDuty 30A premi=C3=A8re g=C3=A9n=C3=A9ration
> >
> >
> > ------------------------------
> > Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=C3=A9 =
=C3=A0 la discussion
> > ci-dessous:
> >
> >
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Programmation-pre=
chauffage-Leaf-2016-30kw-tp104517p104525.html
> > Pour vous d=C3=A9sabonner de Programmation pr=C3=A9chauffage Leaf 2016 =
30kw,
> cliquez
> > ici
> > <
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/template/NamlServ=
let.jtp?macro=3Dunsubscribe_by_code&node=3D104517&code=3DR2VzdGlvbmVyZWNvbn=
NlaWxzQGdtYWlsLmNvbXwxMDQ1MTd8MTY4ODM1NTI2NA=3D=3D>
> > .
> > NAML
> > <
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/template/NamlServ=
let.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml>
> vlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml%3E>
> >
> --
> *Carole Tr=C3=A9panier*, ACC, DBA
> 514 222-0586
>
> <
> https://ca.linkedin.com/pub/carole-tr%C3%A9panier-acc-dba-pl-fin/3/640/71=
>
> 1%3E>
>
> L'avantage est que la recharge tend =C3=A0 r=C3=A9chauffer la batterie. E=
n
> programmant la recharge avant votre d=C3=A9part, vous partez ainsi avec u=
ne
> batterie bien chaude et efficace.
>
> Si vous rechargez votre batterie =C3=A0 votre arriv=C3=A9e vers les 18h, =
votre
> batterie aura le temps de refroidir et sera donc moins efficace.
>
>
> ------------------------------
> Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=C3=A9 =
=C3=A0 la discussion
> ci-dessous:
>
> http://menu-principal-forums-aveq.1097349.n5.nabble.com/Programmation-pre=
chauffage-Leaf-2016-30kw-tp104517p104619.html
> Pour vous d=C3=A9sabonner de Programmation pr=C3=A9chauffage Leaf 2016 30=
kw, cliquez
> ici
> vlet.jtp?macro=3Dunsubscribe_by_code&node=3D104517&code=3DR2VzdGlvbmVyZWNvb=
nNlaWxzQGdtYWlsLmNvbXwxMDQ1MTd8MTY4ODM1NTI2NA=3D=3D>
> .
> NAML
> vlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=
=3Dnabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNam=
espace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscrib=
ers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant=
_email%21nabble%3Aemail.naml>
>

--000000000000b05c670580f33d4e
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

D' accord. Merci!

_signature">Carole Trepanier
514 222-0586

mail_quote">
Le sam. 2 f=C3=A9vr. 2019 20 h 16, Sebas [via =
Menu principal - Forums AV=C3=89Q] < 19h49@n5.nabble.com">ml+s1097349n104619h49@n5.nabble.com> a =C3=A9cr=
it=C2=A0:
.8ex;border-left:1px #ccc solid;padding-left:1ex">

"m_2148505381627508226quote m_2148505381627508226dark-border-color">
ass=3D"m_2148505381627508226quote m_2148505381627508226light-border-color">
>Carole T wrote

kable-quote">Bonsoir Benoit, quel est l=E2=80=99avantage de faire cela plut=
=C3=B4t que de la charger

d=C3=A8s =C2=A0qu=E2=80=99on branche l=E2=80=99auto? Si j=E2=80=99ai bi=
en compris, lorsque le chauffage va

partir le lendemain matin, il va prendre l=E2=80=99=C3=A9nergie de la b=
atterie de la

meme fa=C3=A7on...


Le ven. 1 f=C3=A9vr. 2019 =C3=A0 08:25, Benoit Deslauriers [via Men=
u principal -

Forums AV=C3=89Q] < &node=3D104619&i=3D0" rel=3D"nofollow noreferrer" link=3D"external"=
target=3D"_blank">[hidden email]
> a =C3=A9crit :


> Personnellement j'aime mieux mettre une heure de d=C3=A9pa=
rt de la charge

> plut=C3=B4t qu'une heure de fin. La Leaf 30 kW charge compl=C3=
=A8tement en environ 5

> heures (j'ai aussi une 30 kWh). J'ai donc programm=C3=A9 l=
a recharge pour

> d=C3=A9buter =C3=A0 23H30... comme =C3=A7a si elle est compl=C3=A8=
tement vide elle sera pleine

> aux alentour de 5H00-5H30 et ma femme quitte vers 6H20... =C3=A7a =
laisse donc du

> temps en masse pour le chauffage. Si elle est moins pleine bin ell=
e sera =C3=A0

> 100% plus aux alentour de 2 ou 3 heure du matin. Ce n'Est pas =
tellement

> grave de laisser la batterie pleine quelques heures.

>

> Benoit Deslauriers

> Chevrolet Spark EV noire 38 000 ekm

> Nissan Leaf SV 2016 rouge 52 000 ekm

> Borne EvDuty 30A premi=C3=A8re g=C3=A9n=C3=A9ration

>

>

> ------------------------------

> Si vous r=C3=A9pondez =C3=A0 cet email, votre message sera ajout=
=C3=A9 =C3=A0 la discussion

> ci-dessous:

>

> /Programmation-prechauffage-Leaf-2016-30kw-tp104517p104525.html" rel=3D"nof=
ollow noreferrer" link=3D"external" target=3D"_blank">http://menu-principal=
-forums-aveq.1097349.n5.nabble.com/Programmation-prechauffage-Leaf-2016-30k=
w-tp104517p104525.html

> Pour vous d=C3=A9sabonner de Programmati=
on pr=C3=A9chauffage Leaf 2016 30kw, cliquez

> ici

> < .com/template/NamlServlet.jtp?macro=3Dunsubscribe_by_code&node=3D104517=
&code=3DR2VzdGlvbmVyZWNvbnNlaWxzQGdtYWlsLmNvbXwxMDQ1MTd8MTY4ODM1NTI2NA=
=3D=3D%3E" rel=3D"nofollow noreferrer" link=3D"external" target=3D"_blank">=
http://menu-principal-forums-aveq.1097349.n5.nabble.com/template/NamlServle=
t.jtp?macro=3Dunsubscribe_by_code&node=3D104517&code=3DR2VzdGlvbmVy=
ZWNvbnNlaWxzQGdtYWlsLmNvbXwxMDQ1MTd8MTY4ODM1NTI2NA=3D=3D>

> .

> NAML

> < .com/template/NamlServlet.jtp?macro=3Dmacro_viewer&id=3Dinstant_html%21=
nabble%3Aemail.naml&base=3Dnabble.naml.namespaces.BasicNamespace-nabble=
.view.web.template.NabbleNamespace-nabble.view.web.template.NodeNamespace&a=
mp;breadcrumbs=3Dnotify_subscribers%21nabble%3Aemail.naml-instant_emails%21=
nabble%3Aemail.naml-send_instant_email%21nabble%3Aemail.naml%3E" rel=3D"nof=
ollow noreferrer" link=3D"external" target=3D"_blank">http://menu-principal=
-forums-aveq.1097349.n5.nabble.com/template/NamlServlet.jtp?macro=3Dmacro_v=
iewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=3Dnabble.naml.na=
mespaces.BasicNamespace-nabble.view.web.template.NabbleNamespace-nabble.vie=
w.web.template.NodeNamespace&breadcrumbs=3Dnotify_subscribers%21nabble%=
3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_instant_email%21nabb=
le%3Aemail.naml>

>

--=20

*Carole Tr=C3=A9panier*, ACC, DBA

514 222-0586


< c-dba-pl-fin/3/640/71%3E" rel=3D"nofollow noreferrer" link=3D"external" tar=
get=3D"_blank">https://ca.linkedin.com/pub/carole-tr%C3%A9panier-acc-dba-pl=
-fin/3/640/71>


L'avantage est que la recharge tend =C3=A0 r=C3=A9chauffer la batterie.=
En programmant la recharge avant votre d=C3=A9part, vous partez ainsi avec=
une batterie bien chaude et efficace.


Si vous rechargez votre batterie =C3=A0 votre arriv=C3=A9e vers les=
18h, votre batterie aura le temps de refroidir et sera donc moins efficace=
. =C2=A0



=09
=09
=09









--000000000000b05c670580f33d4e--
Nissan Leaf 2016 30 KW Californienne

Répondre

Retourner vers « Besoin d'aide »